Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0911 [new locus tag: SACOL_RS04675 ]
- pan locus tag?: SAUPAN002883000
- symbol: SACOL0911
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0911 [new locus tag: SACOL_RS04675 ]
- symbol: SACOL0911
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 918606..918806
- length: 201
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3237755 NCBI
- RefSeq: YP_185782 NCBI
- BioCyc: see SACOL_RS04675
- MicrobesOnline: 912382 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGATGTAGATAATATGAGTGATTATAAATTAAAAATAATTGAATTGATCAAAAGTGAT
ATAACAGGTTACCAAATTCACAAACAAACTGGCGTAGCGCAATATGTAATTTCACAATTA
AGACAAGGAAAGCGCGAAGTAGATAACTTAACTTTAAATACAACTGAAAAACTATACAGT
TACGCACGACAAGTGTTATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0911 [new locus tag: SACOL_RS04675 ]
- symbol: SACOL0911
- description: hypothetical protein
- length: 66
- theoretical pI: 8.87407
- theoretical MW: 7678.75
- GRAVY: -0.484848
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage protein
- PFAM: HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9486
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.0498
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006224
- TAT(Tat/SPI): 0.000281
- LIPO(Sec/SPII): 0.001112
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDVDNMSDYKLKIIELIKSDITGYQIHKQTGVAQYVISQLRQGKREVDNLTLNTTEKLYSYARQVL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)