Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1119 [new locus tag: SACOL_RS05715 ]
- pan locus tag?: SAUPAN003337000
- symbol: SACOL1119
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1119 [new locus tag: SACOL_RS05715 ]
- symbol: SACOL1119
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1129312..1129479
- length: 168
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237984 NCBI
- RefSeq: YP_185983 NCBI
- BioCyc: see SACOL_RS05715
- MicrobesOnline: 912587 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGAGACAAGTGCAATGCATTATCTGTGATGCAAAAGTATTTATAGATGAGCGCACAACT
GAGTCTAAACGACTTAAAAACAATCCTATTCGAACATTTATGTGTGATGATTGTAAAAGT
CGATTAGACACACCTAAACAACGTGCGCAACACTATCCGCTCGATTAA60
120
168
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1119 [new locus tag: SACOL_RS05715 ]
- symbol: SACOL1119
- description: hypothetical protein
- length: 55
- theoretical pI: 8.67223
- theoretical MW: 6557.56
- GRAVY: -0.88
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Uncharacterized protein YlaI
- PFAM: no clan defined DUF2197; Uncharacterized protein conserved in bacteria (DUF2197) (PF09963; HMM-score: 74.2)and 6 moreDUF4428; Domain of unknown function (DUF4428) (PF14471; HMM-score: 15.3)C2H2-zf (CL0361) zf_UBZ; Ubiquitin-Binding Zinc Finger (PF18439; HMM-score: 15.1)Zn_Beta_Ribbon (CL0167) FdhE_C; FdhE, C-terminal domain (PF24860; HMM-score: 14.9)no clan defined zf-HYPF; HypF finger (PF07503; HMM-score: 14.6)Zn_Beta_Ribbon (CL0167) Lar_restr_allev; Restriction alleviation protein Lar (PF14354; HMM-score: 13.1)C2H2-zf (CL0361) zf-C2H2_jaz; Zinc-finger double-stranded RNA-binding (PF12171; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9686
- Cytoplasmic Membrane Score: 0.0104
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0203
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.042593
- TAT(Tat/SPI): 0.002697
- LIPO(Sec/SPII): 0.015971
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRQVQCIICDAKVFIDERTTESKRLKNNPIRTFMCDDCKSRLDTPKQRAQHYPLD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)