Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1210 [new locus tag: SACOL_RS06200 ]
- pan locus tag?: SAUPAN003478000
- symbol: pyrR
- pan gene symbol?: pyrR
- synonym:
- product: bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1210 [new locus tag: SACOL_RS06200 ]
- symbol: pyrR
- product: bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase
- replicon: chromosome
- strand: +
- coordinates: 1217368..1217895
- length: 528
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237157 NCBI
- RefSeq: YP_186073 NCBI
- BioCyc: see SACOL_RS06200
- MicrobesOnline: 912678 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGTCTGAACGTATCATAATGGATGATGCCGCAATACAACGTACAGTGACGAGAATCGCT
CACGAAATTTTGGAGTATAACAAAGGTACTGATAATTTAATTCTTTTAGGTATCAAAACA
AGAGGTGAATATTTAGCGAATCGTATACAAGATAAAATTCATCAAATTGAGCAACAACGT
ATACCTACTGGAACAATTGATATTACATACTTTAGAGATGATATAGAGCACATGTCATCA
CTTACGACAAAAGACGCAATAGACATCGACACAGATATTACAGATAAAGTAGTCATCATT
ATTGACGATGTGCTGTATACTGGTCGAACGGTTCGTGCTTCACTTGATGCTATTTTGCTA
AATGCTAGACCTATTAAAATTGGTTTAGCTGCTTTGGTTGATCGAGGACATCGTGAGTTA
CCAATTCGAGCAGATTTTGTTGGTAAAAATATACCTACTTCTAAAGAGGAAACGGTAAGT
GTCTATTTAGAAGAAATGGATCAAAGAAATGCAGTTATAATTAAATAA60
120
180
240
300
360
420
480
528
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1210 [new locus tag: SACOL_RS06200 ]
- symbol: PyrR
- description: bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase
- length: 175
- theoretical pI: 5.08873
- theoretical MW: 19854.6
- GRAVY: -0.196
⊟Function[edit | edit source]
- reaction: EC 2.4.2.9? ExPASyUracil phosphoribosyltransferase UMP + diphosphate = uracil + 5-phospho-alpha-D-ribose 1-diphosphate
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides hypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 44.3)and 5 morePurines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides adenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 17.1)Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis ribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 16.2)Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis orotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 15.2)Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis orotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 13.9)Cellular processes DNA transformation comF family protein (TIGR00201; HMM-score: 11.5)
- TheSEED :
- Pyrimidine operon regulatory protein PyrR
Nucleosides and Nucleotides Pyrimidines De Novo Pyrimidine Synthesis Pyrimidine operon regulatory protein PyrRand 2 more - PFAM: PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 68.4)and 2 morePRTase_2; Phosphoribosyl transferase (PF15609; HMM-score: 13.6)PRTase_3; PRTase ComF-like (PF15610; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002036
- TAT(Tat/SPI): 0.000168
- LIPO(Sec/SPII): 0.000277
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSERIIMDDAAIQRTVTRIAHEILEYNKGTDNLILLGIKTRGEYLANRIQDKIHQIEQQRIPTGTIDITYFRDDIEHMSSLTTKDAIDIDTDITDKVVIIIDDVLYTGRTVRASLDAILLNARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVSVYLEEMDQRNAVIIK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 323 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for NCTC8325
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 34.55 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)