From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1226 [new locus tag: SACOL_RS06280 ]
  • pan locus tag?: SAUPAN003497000
  • symbol: SACOL1226
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1226 [new locus tag: SACOL_RS06280 ]
  • symbol: SACOL1226
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1236903..1237181
  • length: 279
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTTGAACTAAAAGTGGGTATAATAAAAAGAGAAGCTAATGTCATTATAAGCAATTCA
    ACTGGAGGGAAAGAAATGCAAGTAAACAAAGTTATTTATATTTTATTAGCATTGTTCTTA
    GGTAGTTTTGGTATTCATAAATTTTATGCCGGCAAGAATATGCAAGGTATTCTACACTTA
    ATATTCTGTTGGACAGGTATCCCACACATTTTAGCAATTATTAGTGCAGTGATTACTGTT
    TTCAAACCTGCTGATGAACAAGGTAATGTCACTTTATAA
    60
    120
    180
    240
    279

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1226 [new locus tag: SACOL_RS06280 ]
  • symbol: SACOL1226
  • description: hypothetical protein
  • length: 92
  • theoretical pI: 9.72064
  • theoretical MW: 10145.1
  • GRAVY: 0.643478

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108303: hypothetical protein
  • PFAM:
    no clan defined TM2; TM2 domain (PF05154; HMM-score: 62.1)
    and 1 more
    Borrelia_P13; Borrelia membrane protein P13 (PF05628; HMM-score: 13.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003241
    • TAT(Tat/SPI): 0.000168
    • LIPO(Sec/SPII): 0.004053
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MFELKVGIIKREANVIISNSTGGKEMQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHLIFCWTGIPHILAIISAVITVFKPADEQGNVTL

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1226&oldid=60620"