Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1332 [new locus tag: SACOL_RS06780 ]
- pan locus tag?: SAUPAN003629000
- symbol: SACOL1332
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1332 [new locus tag: SACOL_RS06780 ]
- symbol: SACOL1332
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1349301..1349525
- length: 225
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237283 NCBI
- RefSeq: YP_186186 NCBI
- BioCyc: see SACOL_RS06780
- MicrobesOnline: 912792 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGACAAAAATTATGAACCAGTTTAAAGAAATTTATAATACAATAGAAAAATTACTAAAT
GATAAATCAATATCTAATTATAGAATTAATCAAGACACTGATGTTTCTTATGGTGGTATA
AGTGAATTAAGAAGCGGGAAAAGAAAAGTGAATAATTTAACTTTAGAAACAGCGGAAAAA
CTCTATAATTACCAAAAACAATTAGAAATAATGATTGAAGATTAA60
120
180
225
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1332 [new locus tag: SACOL_RS06780 ]
- symbol: SACOL1332
- description: hypothetical protein
- length: 74
- theoretical pI: 6.80776
- theoretical MW: 8736.87
- GRAVY: -0.798649
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- hypothetical protein transposon-related
- PFAM: HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 21.2)and 2 moreHTH_52; Helix-turn-helix domain (PF18576; HMM-score: 14.5)no clan defined CLU_N; Mitochondrial function, CLU-N-term (PF15044; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9826
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0168
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007219
- TAT(Tat/SPI): 0.000256
- LIPO(Sec/SPII): 0.000543
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKIMNQFKEIYNTIEKLLNDKSISNYRINQDTDVSYGGISELRSGKRKVNNLTLETAEKLYNYQKQLEIMIED
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]