Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1675 [new locus tag: SACOL_RS08545 ]
- pan locus tag?: SAUPAN004218000
- symbol: SACOL1675
- pan gene symbol?: —
- synonym:
- product: TPR domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1675 [new locus tag: SACOL_RS08545 ]
- symbol: SACOL1675
- product: TPR domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1704671..1705339
- length: 669
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237637 NCBI
- RefSeq: YP_186515 NCBI
- BioCyc: see SACOL_RS08545
- MicrobesOnline: 913124 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGATAGATCAACAAACAATTTATCAATACATACAAAATGGAAAAATAGAAGAAGCGTTA
CAAGCATTGTTCGGAAATATCGAAGAAAATCCTACAATTATTGAAAATTATATTAATGCT
GGTATCGTACTTGCTGATGCGAATGAGATTGAAAAGGCAGAGCGTTTTTTCCAAAAAGCT
TTAACAATAGATCCGAAGAATGGCGTCGTATTTTTTAATCTAGCAAATGTATATTATAAT
CAGCAACGTTATCAAGAAGCTATTAAATTATATCAACAAGCATTACAAACAGAGATTGAA
CAAGTTGATTGTAATTATATGATCGGTATGGCGTTTAATCAGTTAGAATCATTTAAGCTG
GCATTGCCGTATTTAATGACTGCTGCGGAACTAGATAAAGACAAAGATGCAGAAGTTCAA
TTTCAATATGGTCTTGTATTATGTCAATTAGAAATGTTTAATGAAGCCATAACTCAACTT
AAACATGTATTAACGATTGATAAAAATCATGTTGATGCAAGATACAATTTGGGCTTAGCG
TTATTTATGAAAAATGAAGATATTGATGAAGCAATAACTCATTTTAAAGAAGCTGTGACT
ATCGACCCTAAACACTTATTAAGTCAGCATGCGCTGAAAACATTCACTAAAATGAAAGAG
GAGGAGTAA60
120
180
240
300
360
420
480
540
600
660
669
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1675 [new locus tag: SACOL_RS08545 ]
- symbol: SACOL1675
- description: TPR domain-containing protein
- length: 222
- theoretical pI: 4.41965
- theoretical MW: 25701.1
- GRAVY: -0.277477
⊟Function[edit | edit source]
- TIGRFAM: type IV pilus biogenesis/stability protein PilW (TIGR02521; HMM-score: 72.1)putative PEP-CTERM system TPR-repeat lipoprotein (TIGR02917; HMM-score: 70.8)and 8 moretype III secretion low calcium response chaperone LcrH/SycD (TIGR02552; HMM-score: 56.5)Transport and binding proteins Amino acids, peptides and amines mitochondrial precursor proteins import receptor (TIGR00990; HMM-score: 49.8)tol-pal system protein YbgF (TIGR02795; HMM-score: 31.4)putative peptide modification system cyclase (TIGR04510; HMM-score: 26.2)Unknown function General heme biosynthesis-associated TPR protein (TIGR00540; HMM-score: 24.5)pentatricopeptide repeat domain (TIGR00756; HMM-score: 21.9)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides adenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 21.4)poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA (TIGR03939; HMM-score: 20.7)
- TheSEED :
- Tetratricopeptide repeat (TPR) family protein
- PFAM: TPR (CL0020) TPR_1; Tetratricopeptide repeat (PF00515; HMM-score: 99.7)TPR_2; Tetratricopeptide repeat (PF07719; HMM-score: 98.2)TPR_8; Tetratricopeptide repeat (PF13181; HMM-score: 93.3)TPR_11; TPR repeat (PF13414; HMM-score: 86.9)and 42 moreTPR_12; Tetratricopeptide repeat (PF13424; HMM-score: 78.9)TPR_19; Tetratricopeptide repeat (PF14559; HMM-score: 68.3)TPR_17; Tetratricopeptide repeat (PF13431; HMM-score: 66.1)TPR_14; Tetratricopeptide repeat (PF13428; HMM-score: 62.1)TPR_16; Tetratricopeptide repeat (PF13432; HMM-score: 61.8)ANAPC3; Anaphase-promoting complex, cyclosome, subunit 3 (PF12895; HMM-score: 56.2)TPR_10; Tetratricopeptide repeat (PF13374; HMM-score: 50.4)TPR_7; Tetratricopeptide repeat (PF13176; HMM-score: 47)TPR_CcmH_CycH; Cytochrome c-type biogenesis protein H TPR domain (PF23914; HMM-score: 45.1)TPR_6; Tetratricopeptide repeat (PF13174; HMM-score: 43.4)TPR_Slam; Surface lipoprotein assembly modifier, N-terminal TPR repeats (PF24575; HMM-score: 36.4)TPR_20; Tetratricopeptide repeat (PF14561; HMM-score: 34.2)T7SS_EccA1_N; T7SS, ESX-1 secretion system protein EccA1, N-terminal domain (PF21545; HMM-score: 32.4)TPR_9; Tetratricopeptide repeat (PF13371; HMM-score: 30.1)TPR-S; Tetratricopeptide Repeats-Sensor (PF20308; HMM-score: 29.5)TOM20_plant; Plant specific mitochondrial import receptor subunit TOM20 (PF06552; HMM-score: 28.4)ARM_TT21_C; Tetratricopeptide repeat protein 21 C-terminal ARM domain (PF25063; HMM-score: 26.7)PPR; PPR repeat (PF01535; HMM-score: 24.9)TPR_NPHP3; Nephrocystin-3 TPR domain (PF24885; HMM-score: 23.4)TPR_15; Tetratricopeptide repeat (PF13429; HMM-score: 21.9)ARM_TT21_4th; Tetratricopeptide repeat protein 21 forth ARM domain (PF25068; HMM-score: 21.8)MIT (CL0745) MIT; MIT (microtubule interacting and transport) domain (PF04212; HMM-score: 20.2)TPR (CL0020) TPR_3; Tetratricopeptide repeat (PF07720; HMM-score: 20.2)ARM_TT21_N; Tetratricopeptide repeat protein 21 N-terminal ARM repeat (PF25062; HMM-score: 20.2)ARM_TT21_5th; TT21 fifth ARM repeats domain (PF25064; HMM-score: 19.9)ARM_TT21; Tetratricopeptide repeat protein 21 ARM repeat (PF25058; HMM-score: 19.7)E_motif; E motif (PF20431; HMM-score: 18.1)NatA_aux_su; N-terminal acetyltransferase A, auxiliary subunit (PF12569; HMM-score: 17.4)PPR_2; PPR repeat family (PF13041; HMM-score: 17.3)no clan defined MatP; MatP N-terminal domain (PF06303; HMM-score: 16)TPR (CL0020) TPR_4; Tetratricopeptide repeat (PF07721; HMM-score: 15.8)TPR_P4H; Prolyl 4-hydroxylase peptide-substrate-binding domain (PF23558; HMM-score: 15.5)SRP_TPR_like; Putative TPR-like repeat (PF17004; HMM-score: 14.2)TPR_27; Plant tetratrico peptide repeats (PF23310; HMM-score: 14.2)no clan defined DUF1512; Protein of unknown function (DUF1512) N-terminal domain (PF07431; HMM-score: 13.6)TPR (CL0020) TPR_21; Tetratricopeptide repeat-like domain (PF09976; HMM-score: 12.8)TPR_MalT; MalT-like TPR region (PF17874; HMM-score: 12.8)Hect (CL0552) HECT_2; HECT-like Ubiquitin-conjugating enzyme (E2)-binding (PF09814; HMM-score: 12.2)TPR (CL0020) EAD11; Effector-associated domain 11 (PF19964; HMM-score: 12.1)Sel1; Sel1 repeat (PF08238; HMM-score: 11.7)Clathrin; Region in Clathrin and VPS (PF00637; HMM-score: 11.6)NADP_Rossmann (CL0063) Bin3; Bicoid-interacting protein 3 (Bin3) (PF06859; HMM-score: 9.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8886
- Cytoplasmic Membrane Score: 0.0614
- Cell wall & surface Score: 0.016
- Extracellular Score: 0.0341
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004087
- TAT(Tat/SPI): 0.000163
- LIPO(Sec/SPII): 0.000383
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIDQQTIYQYIQNGKIEEALQALFGNIEENPTIIENYINAGIVLADANEIEKAERFFQKALTIDPKNGVVFFNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKLALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLALFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 141 [5]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)