From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1802 [new locus tag: SACOL_RS09235 ]
  • pan locus tag?: SAUPAN004430000
  • symbol: SACOL1802
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1802 [new locus tag: SACOL_RS09235 ]
  • symbol: SACOL1802
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1851013..1851435
  • length: 423
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGCAAAAGGTAATTTATTTAAAGCGATTTTAGGTATAGGTGGCGCTGTAGCAGCTGTA
    CTTGTTACACGTAAAGATAGTCGTGACAAGCTGAAAGCAGAATATAATAAATATAAACAA
    GATCCTCAAAGCTATAAAGATAATGCTAAGGATAAAGCGACGCAATTAGGAACAATTGCT
    AATGAAACAATTAAAGAAGTAAAAACAAATCCGAAAGAATATGCTAATAGATTAAAAAAT
    AATCCAAAAGCATTTTTCAAAGAAGAAAAATCAAAATTTACCGAATATGACAATAAGACT
    GACGAAAGTATTGAAAAAGGTAAATTTGATGATGAAGGTGGCGCAGCACCAAATAATAAT
    TTACGTATCGTCACTGAAGAAGATTTAAAAAAGAATAAAAATGCATTATCTGATAAAGAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    423


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1802 [new locus tag: SACOL_RS09235 ]
  • symbol: SACOL1802
  • description: hypothetical protein
  • length: 140
  • theoretical pI: 9.81446
  • theoretical MW: 15733.5
  • GRAVY: -1.15286

Function[edit | edit source]

  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 18)
  • TheSEED  :
    • Hypothetical protein SAV1752
  • PFAM:
    no clan defined YtxH; YtxH-like protein (PF12732; HMM-score: 24.5)
    and 3 more
    Ribonuclease; ribonuclease (PF00545; HMM-score: 13.8)
    SOGA; Protein SOGA (PF11365; HMM-score: 10.4)
    TMPIT; TMPIT-like protein (PF07851; HMM-score: 8.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0028
    • Cytoplasmic Membrane Score: 0.7003
    • Cell wall & surface Score: 0.1254
    • Extracellular Score: 0.1716
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.5
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 5
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.307563
    • TAT(Tat/SPI): 0.078886
    • LIPO(Sec/SPII): 0.117906
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAKGNLFKAILGIGGAVAAVLVTRKDSRDKLKAEYNKYKQDPQSYKDNAKDKATQLGTIANETIKEVKTNPKEYANRLKNNPKAFFKEEKSKFTEYDNKTDESIEKGKFDDEGGAAPNNNLRIVTEEDLKKNKNALSDKE

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Signal peptide containing [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [4] [5]   other strains

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 9.81 h [6]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  5. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  6. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]