Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1807 [new locus tag: SACOL_RS09260 ]
- pan locus tag?: SAUPAN004440000
- symbol: SACOL1807
- pan gene symbol?: —
- synonym:
- product: rhodanese-like domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1807 [new locus tag: SACOL_RS09260 ]
- symbol: SACOL1807
- product: rhodanese-like domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1862483..1862794
- length: 312
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236032 NCBI
- RefSeq: YP_186640 NCBI
- BioCyc: see SACOL_RS09260
- MicrobesOnline: 913251 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAGTCAATTACTACAGATGAATTAAAAAATAAACTTTTAGAATCTAAACCAGTTCAA
ATTGTTGATGTTCGTACTGATGAAGAAACAGCAATGGGATATATTCCTAATGCAAAGTTA
ATTCCAATGGATACCATTCCGGATAATTTAAATTCATTTAATAAAAATGAAATATATTAT
ATTGTATGTGCTGGTGGAGTTCGAAGCGCTAAAGTTGTAGAATATTTAGAGGCAAATGGC
ATTGATGCCGTAAATGTCGAAGGCGGCATGCACGCATGGGGCGATGAAGGTTTGGAAATA
AAAAGTATTTAA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1807 [new locus tag: SACOL_RS09260 ]
- symbol: SACOL1807
- description: rhodanese-like domain-containing protein
- length: 103
- theoretical pI: 4.30237
- theoretical MW: 11343.9
- GRAVY: -0.220388
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 24)thiazole biosynthesis domain (TIGR04271; HMM-score: 24)and 2 moreProtein synthesis tRNA and rRNA base modification selenouridine synthase, SelU N-terminal-like subunit (TIGR04568; HMM-score: 13.1)phage shock operon rhodanese PspE (TIGR02981; EC 2.8.1.1; HMM-score: 12.9)
- TheSEED :
- Ankyrin
- Rhodanese domain protein
Potassium metabolism Potassium metabolism - no subcategory Glutathione-regulated potassium-efflux system and associated functions Rhodanese-like domain proteinand 1 more - PFAM: Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 57.9)and 3 more5_3_exonuc_C (CL0464) RNaseH_C; T4 RNase H, C terminal (PF09293; HMM-score: 13.4)NADP_Rossmann (CL0063) CoA_binding_2; CoA binding domain (PF13380; HMM-score: 13.3)DHFred (CL0387) RibD_C; RibD C-terminal domain (PF01872; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.993
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0064
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01276
- TAT(Tat/SPI): 0.000684
- LIPO(Sec/SPII): 0.001797
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYYIVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 262 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 20.67 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)