Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1842 [new locus tag: SACOL_RS09450 ]
- pan locus tag?: SAUPAN004509000
- symbol: SACOL1842
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1842 [new locus tag: SACOL_RS09450 ]
- symbol: SACOL1842
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1897009..1897266
- length: 258
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238245 NCBI
- RefSeq: YP_186673 NCBI
- BioCyc:
- MicrobesOnline: 913286 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAAAGATATTCTTGGCGATGATTCATTTTTATCAACGTTTCATTTCGCCACTCACT
CCACCAACTTGTCGTTTTTATCCAACATGTTCAGAGTACACTAGAGAAGCGATTCAATAC
CACGGTGCTTTCAAAGGCCTTTATTTAGGTATCCGTCGTATTTTAAAATGTCATCCGCTT
CATAAAGGCGGCTTTGACCCTGTTCCGTTAAAAAAAGACAAGTCAGCAAGCAAGCATTCA
CATAAACATAACCATTAA60
120
180
240
258
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1842 [new locus tag: SACOL_RS09450 ]
- symbol: SACOL1842
- description: hypothetical protein
- length: 85
- theoretical pI: 10.5102
- theoretical MW: 9966.69
- GRAVY: -0.529412
⊟Function[edit | edit source]
- TIGRFAM: Hypothetical proteins Conserved putative membrane protein insertion efficiency factor (TIGR00278; HMM-score: 108.9)
- TheSEED:
- PFAM: no clan defined Haemolytic; Haemolytic domain (PF01809; HMM-score: 107.4)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.059906
- TAT(Tat/SPI): 0.002175
- LIPO(Sec/SPII): 0.027373
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKIFLAMIHFYQRFISPLTPPTCRFYPTCSEYTREAIQYHGAFKGLYLGIRRILKCHPLHKGGFDPVPLKKDKSASKHSHKHNH
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SACOL1842 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑
Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑
Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]