From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1842 [new locus tag: SACOL_RS09450 ]
  • pan locus tag?: SAUPAN004509000
  • symbol: SACOL1842
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1842 [new locus tag: SACOL_RS09450 ]
  • symbol: SACOL1842
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1897009..1897266
  • length: 258
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAAAGATATTCTTGGCGATGATTCATTTTTATCAACGTTTCATTTCGCCACTCACT
    CCACCAACTTGTCGTTTTTATCCAACATGTTCAGAGTACACTAGAGAAGCGATTCAATAC
    CACGGTGCTTTCAAAGGCCTTTATTTAGGTATCCGTCGTATTTTAAAATGTCATCCGCTT
    CATAAAGGCGGCTTTGACCCTGTTCCGTTAAAAAAAGACAAGTCAGCAAGCAAGCATTCA
    CATAAACATAACCATTAA
    60
    120
    180
    240
    258

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1842 [new locus tag: SACOL_RS09450 ]
  • symbol: SACOL1842
  • description: hypothetical protein
  • length: 85
  • theoretical pI: 10.5102
  • theoretical MW: 9966.69
  • GRAVY: -0.529412

Function[edit | edit source]

  • TIGRFAM:
    Hypothetical proteins Conserved putative membrane protein insertion efficiency factor (TIGR00278; HMM-score: 108.9)
  • TheSEED:  
    Clustering-based subsystems Cell Division Cell Division Subsystem including YidCD  Protein YidD
  • PFAM:
    no clan defined Haemolytic; Haemolytic domain (PF01809; HMM-score: 107.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.059906
    • TAT(Tat/SPI): 0.002175
    • LIPO(Sec/SPII): 0.027373
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKIFLAMIHFYQRFISPLTPPTCRFYPTCSEYTREAIQYHGAFKGLYLGIRRILKCHPLHKGGFDPVPLKKDKSASKHSHKHNH

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SACOL1842 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]