From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2250 [new locus tag: SACOL_RS11830 ]
  • pan locus tag?: SAUPAN005715000
  • symbol: SACOL2250
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2250 [new locus tag: SACOL_RS11830 ]
  • symbol: SACOL2250
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2315584..2315748
  • length: 165
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGTCTTTAGAAAACCAACTAGCCGAACTTAAATATGATTATGTTCGTCTTCAAGGTGAC
    ATAGAAAAACGGGAATCTTTGAATTTAGATACTTCCGCACTTGTTCGTCAACTTAAAGAT
    ATTGAAAATGAAATTAGAAACGTTCGTGCTCAAATGCAAGATTAA
    60
    120
    165

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2250 [new locus tag: SACOL_RS11830 ]
  • symbol: SACOL2250
  • description: hypothetical protein
  • length: 54
  • theoretical pI: 4.46473
  • theoretical MW: 6394.16
  • GRAVY: -0.825926

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical protein SAV2259
  • PFAM:
    no clan defined TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 20.3)
    and 1 more
    GTP-bdg_M; GTP-binding GTPase Middle Region (PF16360; HMM-score: 13)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006623
    • TAT(Tat/SPI): 0.000892
    • LIPO(Sec/SPII): 0.001715
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSLENQLAELKYDYVRLQGDIEKRESLNLDTSALVRQLKDIENEIRNVRAQMQD

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: 119 [1]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL2250&oldid=85773"