From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2339 [new locus tag: SACOL_RS12285 ]
  • pan locus tag?: SAUPAN005841000
  • symbol: SACOL2339
  • pan gene symbol?: aag
  • synonym:
  • product: DNA-3-methyladenine glycosylase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2339 [new locus tag: SACOL_RS12285 ]
  • symbol: SACOL2339
  • product: DNA-3-methyladenine glycosylase
  • replicon: chromosome
  • strand: +
  • coordinates: 2398834..2399442
  • length: 609
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGATTTCGTTAATAATGATACAAGACAAATTGCTAAAAACTTATTAGGTGTCAAAGTG
    ATTTATCAGGATACCACTCAAACGTATACAGGCTACATCGTGGAAACGGAAGCTTACTTA
    GGTTTGAATGATCGTGCGGCTCATGGCTATGGCGGTAAAATAACACCTAAAGTCACGTCA
    TTATATAAACGTGGTGGTACAATTTATGCACATGTCATGCATACGCATTTACTCATTAAT
    TTTGTAACAAAATCTGAAGGTATACCTGAAGGCGTACTTATCCGCGCAATTGAACCAGAA
    GAAGGTTTATCCGCTATGTTCCGTAACAGAGGTAAGAAAGGCTACGAGGTAACGAATGGC
    CCAGGAAAATGGACTAAGGCATTTAACATTCCACGGGCTATCGATGGCGCTACGTTAAAT
    GACTGTAGATTGTCTATTGATACTAAGAATCGTAAATATCCTAAAGATATTATTGCTAGT
    CCACGAATCGGTATTCCAAATAAAGGTGATTGGACACATAAATCTTTACGTTACACAGTG
    AAAGGTAATCCATTTGTGTCTCGCATGCGTAAATCAGATTGTATGTTTCCCGAAGATACT
    TGGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    609

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2339 [new locus tag: SACOL_RS12285 ]
  • symbol: SACOL2339
  • description: DNA-3-methyladenine glycosylase
  • length: 202
  • theoretical pI: 10.103
  • theoretical MW: 22770.9
  • GRAVY: -0.547525

Function[edit | edit source]

  • reaction:
    EC 3.2.2.-?  ExPASy
  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA-3-methyladenine glycosylase (TIGR00567; EC 3.2.2.-; HMM-score: 156.9)
  • TheSEED:  
    DNA Metabolism DNA repair DNA Repair Base Excision  DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
  • PFAM:
    no clan defined Pur_DNA_glyco; Methylpurine-DNA glycosylase (MPG) (PF02245; HMM-score: 161)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.03823
    • TAT(Tat/SPI): 0.001482
    • LIPO(Sec/SPII): 0.001339
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MDFVNNDTRQIAKNLLGVKVIYQDTTQTYTGYIVETEAYLGLNDRAAHGYGGKITPKVTSLYKRGGTIYAHVMHTHLLINFVTKSEGIPEGVLIRAIEPEEGLSAMFRNRGKKGYEVTNGPGKWTKAFNIPRAIDGATLNDCRLSIDTKNRKYPKDIIASPRIGIPNKGDWTHKSLRYTVKGNPFVSRMRKSDCMFPEDTWK

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SACOL2339 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]