Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2351 [new locus tag: SACOL_RS12345 ]
- pan locus tag?: SAUPAN005860000
- symbol: SACOL2351
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2351 [new locus tag: SACOL_RS12345 ]
- symbol: SACOL2351
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2410997..2411125
- length: 129
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236066 NCBI
- RefSeq: YP_187157 NCBI
- BioCyc: see SACOL_RS12345
- MicrobesOnline: 913832 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGAATACAAACAACATCCTTTCAAAGTATTTACAATTAGTGTGAATTACTTTGAAGGG
ATTGTTTTTTGTGGAAAAATTTATGAAGTGCTGAGGTTTATATCATTTTATACCTTTTAT
AAGTTGTAA60
120
129
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2351 [new locus tag: SACOL_RS12345 ]
- symbol: SACOL2351
- description: hypothetical protein
- length: 42
- theoretical pI: 9.05275
- theoretical MW: 5197.1
- GRAVY: 0.32619
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7387
- Cytoplasmic Membrane Score: 0.0027
- Cell wall & surface Score: 0
- Extracellular Score: 0.2585
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.83
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.098999
- TAT(Tat/SPI): 0.000782
- LIPO(Sec/SPII): 0.06377
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEYKQHPFKVFTISVNYFEGIVFCGKIYEVLRFISFYTFYKL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.