Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2383 [new locus tag: SACOL_RS12505 ]
- pan locus tag?: SAUPAN005912000
- symbol: SACOL2383
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2383 [new locus tag: SACOL_RS12505 ]
- symbol: SACOL2383
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2442842..2443207
- length: 366
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238644 NCBI
- RefSeq: YP_187187 NCBI
- BioCyc: see SACOL_RS12505
- MicrobesOnline: 913863 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAGAAGAAAAAAAACGCGATTAAAGTTATCATTATATTATTTATTTCATTAATTGTT
GCAGTAGCATTTTTCTTTGGTCTGAAAACATATCAAGGCCATAAGAATATTCAACTAATT
GACAGTTACTTGGAAGAGAAAAATCTAAAAGATAAAATTAAATCAGAAAAAACAGAGTAT
AGTGCTAAAAAAGGTCTCTTCTATAAGGAAGTTACATTTAAAGATGAACCTGGTGTAACT
TATGTTGTGCAACCAATCAGTACTAATAAAGGATTATTTGTTGAAGGCTTTGATACAGAG
ACTAAGAAAAGTTTGAAAACTGCAAAGCATAAATATTTCAATCAAAATTATAAACCATCA
AAATAG60
120
180
240
300
360
366
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2383 [new locus tag: SACOL_RS12505 ]
- symbol: SACOL2383
- description: hypothetical protein
- length: 121
- theoretical pI: 10.3674
- theoretical MW: 14007.3
- GRAVY: -0.459504
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108216: hypothetical protein
- PFAM: no clan defined DUF3139; Protein of unknown function (DUF3139) (PF11337; HMM-score: 71.6)and 4 moreO-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 18.5)no clan defined Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 16)O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 13.9)no clan defined DUF2648; Protein of unknown function (DUF2648) (PF10855; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.230821
- TAT(Tat/SPI): 0.000613
- LIPO(Sec/SPII): 0.042263
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKKKNAIKVIIILFISLIVAVAFFFGLKTYQGHKNIQLIDSYLEEKNLKDKIKSEKTEYSAKKGLFYKEVTFKDEPGVTYVVQPISTNKGLFVEGFDTETKKSLKTAKHKYFNQNYKPSK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Signal peptide containing [1] [2] [3] [4]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)