From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2493 [new locus tag: SACOL_RS13060 ]
  • pan locus tag?: SAUPAN006068000
  • symbol: SACOL2493
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2493 [new locus tag: SACOL_RS13060 ]
  • symbol: SACOL2493
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2545896..2546690
  • length: 795
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGATTCATTCAAAGAAATTAACGCTCGGTATATGCTTGGTATTACTCATTATATTGATT
    GTAGGTTATGTCATTATGACAAAAACAAATGGTCGAAACGCCCAAATTAAAGACACATTT
    AATCAAACATTAAAATTATATCCAACCAAAAATCTCGATGATTTTTACGATAAAGAAGGC
    TTTCGAGATCAAGAATTTAAAAAGGGTGATAAAGGTACTTGGATAGTTAATTCTGAAATG
    GTAATCGAGCCAAAAGGTAAGGATATGGAAACGAGAGGAATGGTGCTCTATATCAATCGC
    AATACTAGAACCACAAAAGGGTATTATTTTATAAGTGAAATGACAGATGACAGTAACGGC
    AGACCAAAGGATGATGAAAAAAGGTATCCGGTAAAAATGGAACATAATAAAATCATACCA
    ACGAAGCCACTACCGAATGACAAGTTAAAAAAAGAGATTGAAAACTTTAAGTTCTTTGTA
    CAATATGGCAACTTTAAAGATATTAATGATTATAAAGATGGTGATATTTCATATAATCCT
    AATGTACCAAGTTATTCGGCAAAATATCAATTGAATAATGATGATTATAATGTCCAACAG
    TTAAGAAAAAGATATGATATTCCAACCAAACAAGCGCCGAAACTATTATTGAAAGGCGAT
    GGAGATTTAAAAGGTTCATCCGTAGGTTCTAGAAGTCTTGAATTTACCTTTGTCGAAAAT
    AAAGAAGAAAACATTTATTTTACAGATTCTGTACAATATACTCCAAGTGAGGATACAAGG
    TATGAGTCAAACTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    795

Protein[edit | edit source]

Protein Data Bank: 4EG9
Protein Data Bank: 4EGD

General[edit | edit source]

  • locus tag: SACOL2493 [new locus tag: SACOL_RS13060 ]
  • symbol: SACOL2493
  • description: hypothetical protein
  • length: 264
  • theoretical pI: 8.95441
  • theoretical MW: 30799.7
  • GRAVY: -0.864015

Function[edit | edit source]

  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 342.8)
  • TheSEED:  
    FIG01107840: hypothetical protein
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 425.4)
    and 1 more
    4HB_MCP (CL0457) 4HB_MCP_1; Four helix bundle sensory module for signal transduction (PF12729; HMM-score: 14.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 31 aa
    • SP(Sec/SPI): 0.603004
    • TAT(Tat/SPI): 0.001213
    • LIPO(Sec/SPII): 0.140079
    • Cleavage Site: CS pos: 31-32. TNG-RN. Pr: 0.1833
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIHSKKLTLGICLVLLIILIVGYVIMTKTNGRNAQIKDTFNQTLKLYPTKNLDDFYDKEGFRDQEFKKGDKGTWIVNSEMVIEPKGKDMETRGMVLYINRNTRTTKGYYFISEMTDDSNGRPKDDEKRYPVKMEHNKIIPTKPLPNDKLKKEIENFKFFVQYGNFKDINDYKDGDISYNPNVPSYSAKYQLNNDDYNVQQLRKRYDIPTKQAPKLLLKGDGDLKGSSVGSRSLEFTFVENKEENIYFTDSVQYTPSEDTRYESN

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Integral membrane [1]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SACOL2493 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]