Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS00075 [old locus tag: SACOL0011 ]
- pan locus tag?: SAUPAN000019000
- symbol: SACOL_RS00075
- pan gene symbol?: —
- synonym:
- product: membrane protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS00075 [old locus tag: SACOL0011 ]
- symbol: SACOL_RS00075
- product: membrane protein
- replicon: chromosome
- strand: +
- coordinates: 15441..15770
- length: 330
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATAACTCATATGAACATGTTAATACTTATTTTATTGTGTGGTATCGTAACGCTATTA
ATTCGAATTATACCTTTTATCATGATTTCAAAAGTGCAATTGCCTGATGTCGTGGTTCGA
TGGCTATCATTTATCCCAATCACACTATTTACGGCACTTGTCATTGACAGCATTATTCAA
CAGACGCCTCATGGTGAGGGGTATACATTAAACATCCCTTACATTATCGCGCTCATTCCG
ACGGTTATTTTATCTATAATCACGCGTAGTTTAACTATTACAATTATTAGTGGGATTGTT
ATCATGGCAGCATTACGATTTTTCTTTTAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS00075 [old locus tag: SACOL0011 ]
- symbol: SACOL_RS00075
- description: membrane protein
- length: 109
- theoretical pI: 9.29961
- theoretical MW: 12233.1
- GRAVY: 1.47523
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking type II secretion system protein F (TIGR02120; HMM-score: 9.3)
- TheSEED: see SACOL0011
- PFAM: no clan defined AzlD; Branched-chain amino acid transport protein (AzlD) (PF05437; HMM-score: 86.3)and 1 moreABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 14.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9997
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008588
- TAT(Tat/SPI): 0.000285
- LIPO(Sec/SPII): 0.006354
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]