Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS00160 [old locus tag: SACOL0027 ]
- pan locus tag?: SAUPAN000053000
- symbol: SACOL_RS00160
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS00160 [old locus tag: SACOL0027 ]
- symbol: SACOL_RS00160
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 36082..36321
- length: 240
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGTGATAATTTGTCATTATTCATTGACTATATCAATGATAATATAATCTATGGTAGT
GAAATCAAACGGGAGAAATTAGAGAATTTATTTAATCAATTTGCTATAAAAAATGTTGAA
AAGAACATTGTCTATGATGAACTGAAATCTTTAGATATTACAATCATTGAGTCACAGGAT
TCATATAAAAATAAATTGAAGAGATTATTTTCGGTTCTGTTGCAAAGTAAAAAAATATAG60
120
180
240
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS00160 [old locus tag: SACOL0027 ]
- symbol: SACOL_RS00160
- description: hypothetical protein
- length: 79
- theoretical pI: 6.81708
- theoretical MW: 9346.71
- GRAVY: -0.331646
⊟Function[edit | edit source]
- TIGRFAM: phenylacetic acid degradation protein paaN (TIGR02288; HMM-score: 11.6)
- TheSEED: see SACOL0027
- PFAM: no clan defined RecG_N; RecG N-terminal helical domain (PF17190; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001916
- TAT(Tat/SPI): 0.000087
- LIPO(Sec/SPII): 0.00033
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSDNLSLFIDYINDNIIYGSEIKREKLENLFNQFAIKNVEKNIVYDELKSLDITIIESQDSYKNKLKRLFSVLLQSKKI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.