From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS00160 [old locus tag: SACOL0027 ]
  • pan locus tag?: SAUPAN000053000
  • symbol: SACOL_RS00160
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS00160 [old locus tag: SACOL0027 ]
  • symbol: SACOL_RS00160
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 36082..36321
  • length: 240
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (36082..36321) NCBI
  • BioCyc: G1G4B-30 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAGTGATAATTTGTCATTATTCATTGACTATATCAATGATAATATAATCTATGGTAGT
    GAAATCAAACGGGAGAAATTAGAGAATTTATTTAATCAATTTGCTATAAAAAATGTTGAA
    AAGAACATTGTCTATGATGAACTGAAATCTTTAGATATTACAATCATTGAGTCACAGGAT
    TCATATAAAAATAAATTGAAGAGATTATTTTCGGTTCTGTTGCAAAGTAAAAAAATATAG
    60
    120
    180
    240

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS00160 [old locus tag: SACOL0027 ]
  • symbol: SACOL_RS00160
  • description: hypothetical protein
  • length: 79
  • theoretical pI: 6.81708
  • theoretical MW: 9346.71
  • GRAVY: -0.331646

Function[edit | edit source]

  • TIGRFAM:
    phenylacetic acid degradation protein paaN (TIGR02288; HMM-score: 11.6)
  • TheSEED: see SACOL0027
  • PFAM:
    no clan defined RecG_N; RecG N-terminal helical domain (PF17190; HMM-score: 13.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001916
    • TAT(Tat/SPI): 0.000087
    • LIPO(Sec/SPII): 0.00033
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 447205472 NCBI
  • RefSeq: WP_001282728 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSDNLSLFIDYINDNIIYGSEIKREKLENLFNQFAIKNVEKNIVYDELKSLDITIIESQDSYKNKLKRLFSVLLQSKKI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]