Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS01615 [old locus tag: SACOL0320 ]
- pan locus tag?: SAUPAN001419000
- symbol: SACOL_RS01615
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS01615 [old locus tag: SACOL0320 ]
- symbol: SACOL_RS01615
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 356975..357157
- length: 183
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAAATAACTAATTGCAAAATAAAAAAAGAAACTATAGTATATGAAGTTTTAACTAGT
GGTAATCAACCATTCACTTATGAGTTACCTAAAGATTTATCGTCACATAATGCGCGTAAA
TACTTGGAATTTATTTCACAAAAAATAGATGGCGATAAGTTAACCAAAGAAGATTCATTA
TGA60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS01615 [old locus tag: SACOL0320 ]
- symbol: SACOL_RS01615
- description: hypothetical protein
- length: 60
- theoretical pI: 8.46415
- theoretical MW: 6950.93
- GRAVY: -0.695
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL0320
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01744
- TAT(Tat/SPI): 0.000262
- LIPO(Sec/SPII): 0.007577
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKITNCKIKKETIVYEVLTSGNQPFTYELPKDLSSHNARKYLEFISQKIDGDKLTKEDSL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
SACOL_RS01615 is similar to the fifth gene product of prophage ΦSA169 in Staphylococcus aureus SA169. Gp05 is a metabolic inhibitor that impairs the TCA cycle resulting in enhanced pigmentation, ppGpp alarmone synthesis and vancomycin tolerance.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
- ↑ Yi Li, Fengli Zhu, Adhar C Manna, Liang Chen, Jason Jiang, Jong-In Hong, Richard A Proctor, Arnold S Bayer, Ambrose L Cheung, Yan Q Xiong
Gp05, a Prophage-Encoded Virulence Factor, Contributes to Persistent Methicillin-Resistant Staphylococcus aureus Endovascular Infection.
Microbiol Spectr: 2023, 11(4);e0060023
[PubMed:37358448] [WorldCat.org] [DOI] (I p)