From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02025 [old locus tag: SACOL0402 ]
  • pan locus tag?: SAUPAN001865000
  • symbol: SACOL_RS02025
  • pan gene symbol?:
  • synonym:
  • product: PTS ascorbate transporter subunit IIA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS02025 [old locus tag: SACOL0402 ]
  • symbol: SACOL_RS02025
  • product: PTS ascorbate transporter subunit IIA
  • replicon: chromosome
  • strand: -
  • coordinates: 408233..408676
  • length: 444
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (408233..408676) NCBI
  • BioCyc: G1G4B-416 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    GTGTCATTAGACATTTTGTCAACAACACGCATCATTGTAAAAGAACAAGTAAATGATTGG
    ACTGAAGCTATAACTATAGCTTCTCAGCCATTACTACAAGAACAAATTATTGAACAAGGC
    TATGTTCAAGCAATGATTGATAGCGTTAATGAACTTGGACCTTATATCGTTATCGCACCT
    GAAATTGCAATTGCACATGCAAGACCGAACAATGACGTACATCAAGTTGGTTTAAGTCTA
    TTAAAGTTGAATCAACATGTGGCATTTTGTGATGAAGATCACTACGCATCTCTCATTTTT
    GTATTGAGTGCCATCGACAATCATTCACACTTATCTGTATTACAAAATTTAGCAACCGTA
    CTGGGCGATAACCAAACAGTCCAGCAACTATTAACTGCAACAAATGCACAAGACATTAAA
    AACATTTTAAAGGAGCATGATTAA
    60
    120
    180
    240
    300
    360
    420
    444

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS02025 [old locus tag: SACOL0402 ]
  • symbol: SACOL_RS02025
  • description: PTS ascorbate transporter subunit IIA
  • length: 147
  • theoretical pI: 4.41796
  • theoretical MW: 16299.4
  • GRAVY: 0.0680272

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 32.7)
    Signal transduction Signal transduction PTS PTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 32.7)
    Signal transduction Signal transduction PTS PTS IIA-like nitrogen-regulatory protein PtsN (TIGR01419; HMM-score: 28.7)
  • TheSEED:
  • PFAM:
    PTase-anion_tr (CL0340) PTS_EIIA_2; Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359; HMM-score: 107.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003367
    • TAT(Tat/SPI): 0.000205
    • LIPO(Sec/SPII): 0.000224
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 445972907 NCBI
  • RefSeq: WP_000050762 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSLDILSTTRIIVKEQVNDWTEAITIASQPLLQEQIIEQGYVQAMIDSVNELGPYIVIAPEIAIAHARPNNDVHQVGLSLLKLNQHVAFCDEDHYASLIFVLSAIDNHSHLSVLQNLATVLGDNQTVQQLLTATNAQDIKNILKEHD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]