Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS04715 [old locus tag: SACOL0919 ]
- pan locus tag?: SAUPAN003012000
- symbol: SACOL_RS04715
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS04715 [old locus tag: SACOL0919 ]
- symbol: SACOL_RS04715
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 926954..927091
- length: 138
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGATGGTGGATAAAGCGACAACACAAATACAACATGATTGTGGCATTAGAGTGCTGGTC
TTTATTAAATTAATTGAAAGCTACATCAAATATTCTTTAGATAATTCGATATTAGTTCGA
TTAAGATTCGTTGTATAA60
120
138
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS04715 [old locus tag: SACOL0919 ]
- symbol: SACOL_RS04715
- description: hypothetical protein
- length: 45
- theoretical pI: 9.25314
- theoretical MW: 5270.31
- GRAVY: 0.56
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for NCTC8325
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014412
- TAT(Tat/SPI): 0.000693
- LIPO(Sec/SPII): 0.009341
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMVDKATTQIQHDCGIRVLVFIKLIESYIKYSLDNSILVRLRFVV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.