From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05340 [old locus tag: SACOL1046 ]
  • pan locus tag?: SAUPAN003239000
  • symbol: SACOL_RS05340
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS05340 [old locus tag: SACOL1046 ]
  • symbol: SACOL_RS05340
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1054224..1054355
  • length: 132
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (1054224..1054355) NCBI
  • BioCyc: SACOL_RS05340 BioCyc
  • MicrobesOnline: see SACOL1046

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAGGTATGTAACGATGCGCCAATTCATTAAAAGAACTGTTAAAACAATCCTTGTCGGT
    TATGTAATTAAATTTATTCGAAATAAACTTTCAGGTAAATCATCACATCCGACAGATAAT
    AAACATAATTAA
    60
    120
    132

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS05340 [old locus tag: SACOL1046 ]
  • symbol: SACOL_RS05340
  • description: hypothetical protein
  • length: 43
  • theoretical pI: 11.7681
  • theoretical MW: 5107.04
  • GRAVY: -0.551163

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.147601
    • TAT(Tat/SPI): 0.005552
    • LIPO(Sec/SPII): 0.022443
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MRYVTMRQFIKRTVKTILVGYVIKFIRNKLSGKSSHPTDNKHN

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: see SACOL1046
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL_RS05340&oldid=100142"