Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS06055
- pan locus tag?:
- symbol: SACOL_RS06055
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS06055
- symbol: SACOL_RS06055
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1189389..1189616
- length: 228
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACACATTTGACAAAGGTTTTAGATACACTAACTGGAATATGCGTAGTATTATTATTT
AGTAAATATTTTGTGGTGTATGCAAATATGGTGTTTGATTGGAATTTAAGATGGTATTTG
CTAGAAAACATACCACATTTGCCAATTATATTATTTATTCTGATGTTTATTTTCGGAGTA
CCTTCTGAAATGATAAAAGATAGGCAAAGGAAAAATAACGGTGTTTAA60
120
180
228
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS06055
- symbol: SACOL_RS06055
- description: hypothetical protein
- length: 75
- theoretical pI: 9.15991
- theoretical MW: 8890.67
- GRAVY: 0.606667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF1056; Protein of unknown function (DUF1056) (PF06341; HMM-score: 14.3)PsbI; Photosystem II reaction centre I protein (PSII 4.8 kDa protein) (PF02532; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9942
- Cell wall & surface Score: 0
- Extracellular Score: 0.0058
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005106
- TAT(Tat/SPI): 0.000595
- LIPO(Sec/SPII): 0.003763
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTHLTKVLDTLTGICVVLLFSKYFVVYANMVFDWNLRWYLLENIPHLPIILFILMFIFGVPSEMIKDRQRKNNGV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]