Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS07060 [old locus tag: SACOL1387 ]
- pan locus tag?: SAUPAN003739000
- symbol: SACOL_RS07060
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS07060 [old locus tag: SACOL1387 ]
- symbol: SACOL_RS07060
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1394493..1394789
- length: 297
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCAAATAGAACTTACTGATGCAGCAGTAACTTGGTTTAAAAATGAACTTGAGTTGCCT
GAAAATAATAAAGTGCTCGTGTTTTTTGTAAGATATGGTGGCGAATTCCAACTCAAGCAA
GGATTTAGTCCTGCTTTTACAGTTGAACCAAAGGAAGATGTTGATATTGGCTATGAACAA
CAATATGACGATTTAAATGTTGTCGTAGCGGAAAAAGATTTGTGGTACTTTGAAGATGAC
CACATTATTGTAAATGTAGTTGATCACGAAGATGAAATTTCTTATTCCACAAAATAA60
120
180
240
297
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS07060 [old locus tag: SACOL1387 ]
- symbol: SACOL_RS07060
- description: hypothetical protein
- length: 98
- theoretical pI: 3.87549
- theoretical MW: 11495.6
- GRAVY: -0.387755
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other IscR-regulated protein YhgI (TIGR03341; HMM-score: 12.6)
- TheSEED: see SACOL1387
- PFAM: no clan defined Fe-S_biosyn; Iron-sulphur cluster biosynthesis (PF01521; HMM-score: 22.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003119
- TAT(Tat/SPI): 0.00022
- LIPO(Sec/SPII): 0.000294
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQIELTDAAVTWFKNELELPENNKVLVFFVRYGGEFQLKQGFSPAFTVEPKEDVDIGYEQQYDDLNVVVAEKDLWYFEDDHIIVNVVDHEDEISYSTK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.