From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08525 [old locus tag: SACOL1671 ]
  • pan locus tag?: SAUPAN004212000
  • symbol: SACOL_RS08525
  • pan gene symbol?:
  • synonym:
  • product: Holliday junction resolvase RuvX

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS08525 [old locus tag: SACOL1671 ]
  • symbol: SACOL_RS08525
  • product: Holliday junction resolvase RuvX
  • replicon: chromosome
  • strand: -
  • coordinates: 1698464..1698892
  • length: 429
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (1698464..1698892) NCBI
  • BioCyc: G1G4B-1787 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTACAACATAAAATTTTAGGACTCGATGTCGGTAGTAGAACGGTAGGAATTGCAATT
    AGTGATATAATGGGTTGGACGGCACAAGGATTAGACACACTCCGAATCAATGAAGAAAAT
    AATGAATTAGGTATTGACCAATTAGTAGACATTATTAAAAAACATAATGTGGGTACAGTC
    GTAATAGGACTACCTAAAAACATGAATAATTCAATAGGATTTCGAGGCGAAGCTTCGTTA
    ACATATAAAGAAAAATTATTAGAAGCTTATCCTTCTATTGAGATTGTGATGTGGGATGAA
    AGATTAAGCACAATGGCTGCTGAACGATCATTATTAGAAGCAGATGTTTCAAGACAAAAA
    AGAAAACAAGTGATTGATAAAATGGCAGCGGTATTTATTTTACAAGGCTATTTAGATTCA
    CTACATTAA
    60
    120
    180
    240
    300
    360
    420
    429

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS08525 [old locus tag: SACOL1671 ]
  • symbol: SACOL_RS08525
  • description: Holliday junction resolvase RuvX
  • length: 142
  • theoretical pI: 5.68913
  • theoretical MW: 15865.3
  • GRAVY: -0.0711268

Function[edit | edit source]

  • reaction:
    EC 3.1.-.-?  ExPASy
  • TIGRFAM:
    Unknown function General putative transcription antitermination factor YqgF (TIGR00250; HMM-score: 135.7)
    and 1 more
    Metabolism Energy metabolism Other tartrate dehydrogenase (TIGR02089; EC 1.1.1.93; HMM-score: 11.5)
  • TheSEED:
  • PFAM:
    YqgF (CL0580) RuvX; Holliday junction resolvase (PF03652; HMM-score: 139.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.029328
    • TAT(Tat/SPI): 0.001344
    • LIPO(Sec/SPII): 0.004666
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446861803 NCBI
  • RefSeq: WP_000939059 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MLQHKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTVVIGLPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQKRKQVIDKMAAVFILQGYLDSLH

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]