Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS09795 [old locus tag: SACOL1902 ]
- pan locus tag?: SAUPAN004776000
- symbol: SACOL_RS09795
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS09795 [old locus tag: SACOL1902 ]
- symbol: SACOL_RS09795
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1957826..1958170
- length: 345
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAGTAAATTTATATGATTATGCAAATCAATTAGAACAAGCTTTAAGAGAAAGCGAA
GAATACAAAGCAATCAAAGAAGCATTCGCTAATGTAAAAGCTAACGAAGAATCTAAAAAG
TTATTCGACGAGTTCCGTGAAACTCAAATTAACTTCCAACAAAAACAAATGCAAGGTGAA
GAAATTGCTGAAGAAGATTTACAAAAAGCGCAAGAACAAGCGCAAGCAATTGAAAAAGAT
GAAAACATCTCTGCATTAATGAATGCTGAACAAAAAATGAGTCAAGTATTCCAAGAAATC
AACCAAATTATCGTTAAACCATTAGACGAAATTTACGCTGACTAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS09795 [old locus tag: SACOL1902 ]
- symbol: SACOL_RS09795
- description: hypothetical protein
- length: 114
- theoretical pI: 4.03601
- theoretical MW: 13309.7
- GRAVY: -0.845614
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 5.7)
- TheSEED: see SACOL1902
- PFAM: no clan defined Com_YlbF; Control of competence regulator ComK, YlbF/YmcA (PF06133; HMM-score: 90.4)and 8 moreOFCC1; Orofacial cleft 1 candidate gene 1 protein (PF15680; HMM-score: 14.9)OmpH; Outer membrane protein (OmpH-like) (PF03938; HMM-score: 13.9)CompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 12)DUF3347; Protein of unknown function (DUF3347) (PF11827; HMM-score: 11.4)FRB_dom; FKBP12-rapamycin binding domain (PF08771; HMM-score: 11)DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 10.3)AD; Anticodon-binding domain (PF09793; HMM-score: 8.9)TMPIT; TMPIT-like protein (PF07851; HMM-score: 8.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002538
- TAT(Tat/SPI): 0.000329
- LIPO(Sec/SPII): 0.000465
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGEEIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.