From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10135 [old locus tag: SACOL1938 ]
  • pan locus tag?: SAUPAN004894000
  • symbol: SACOL_RS10135
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS10135 [old locus tag: SACOL1938 ]
  • symbol: SACOL_RS10135
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2002237..2002437
  • length: 201
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2002237..2002437) NCBI
  • BioCyc: SACOL_RS10135 BioCyc
  • MicrobesOnline: see SACOL1938

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGACAAATGAAGAGAAAGTATTAGCTATTAGAGAGAAGTTAAATATTGTTAATCAAGGA
    TTATTAGATCCTGAAAAATATAAAAATGCAAATGAAGAAGAATTAACAGATATATATGAT
    TTTGTTCAATCAAGAGAAAGATTGTCGCCAAGTGAAGTGACAGCTATTGCTGACGCTTTA
    GGACAATTGCGACACGAATAG
    60
    120
    180
    201


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS10135 [old locus tag: SACOL1938 ]
  • symbol: SACOL_RS10135
  • description: hypothetical protein
  • length: 66
  • theoretical pI: 4.32201
  • theoretical MW: 7586.41
  • GRAVY: -0.69697

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL1938
  • PFAM:
    no clan defined DUF1128; Protein of unknown function (DUF1128) (PF06569; HMM-score: 82.1)
    and 1 more
    HTH (CL0123) HTH_46; Winged helix-turn-helix DNA binding (PF15977; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8792
    • Cytoplasmic Membrane Score: 0.01
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.1103
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002322
    • TAT(Tat/SPI): 0.000307
    • LIPO(Sec/SPII): 0.000308
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MTNEEKVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSEVTAIADALGQLRHE

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: see SACOL1938
  • quantitative data / protein copy number per cell: see SACOL1938
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]