Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS10435 [old locus tag: SACOL1997 ]
- pan locus tag?: SAUPAN005000000
- symbol: SACOL_RS10435
- pan gene symbol?: pmtR
- synonym:
- product: GntR family transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS10435 [old locus tag: SACOL1997 ]
- symbol: SACOL_RS10435
- product: GntR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2058311..2058691
- length: 381
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (2058311..2058691) NCBI
- BioCyc: SACOL_RS10435 BioCyc
- MicrobesOnline: see SACOL1997
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAATAATTTTAAAAAACAATAGTGATTTTCCGATTTATGAACAGATTAAGCAACAA
GTAAAACAAAATATTTTAAAGGGACATGTTGCTCCTGGAGAGCATTTGCCGTCAATGAGA
GAACTTGCCAAAGATCTTCAAGTAAGTTTGATTACTACCAAACGTGCTTATGAAGATTTA
GAGAAAGACGGTTTTGTTACAACAATTAGAGGAAAAGGGACCTTTGTTAAGGAGCAAGAT
AGTTCTATTTTAAAAGAGAAACAATTTTTTACCATTGAAAATTTGGTTAAAGAATTGGTT
AATGAAGCGCAAGCCATCGAAATGTCACTTGAGGAACTGCAGGATATTTTAACGTTCATT
TATGAGGAGGAATCATCATGA60
120
180
240
300
360
381
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS10435 [old locus tag: SACOL1997 ]
- symbol: SACOL_RS10435
- description: GntR family transcriptional regulator
- length: 126
- theoretical pI: 4.70971
- theoretical MW: 14532.5
- GRAVY: -0.430952
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 59.3)Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 59.3)and 15 moreTransport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 45.2)Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 45.2)Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 43.6)Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 35.1)phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 32.7)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.8)Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 13.5)putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 13.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)DNA metabolism DNA replication, recombination, and repair repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 12.8)Regulatory functions DNA interactions repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 12.8)
- TheSEED: see SACOL1997
- PFAM: HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 64.4)and 13 moreHTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.8)Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 18.1)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 16.9)DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 15.8)no clan defined Uso1_p115_C; Uso1 / p115 like vesicle tethering protein, C terminal region (PF04871; HMM-score: 14.5)SabA_adhesion; SabA N-terminal extracellular adhesion domain (PF18304; HMM-score: 14.4)HTH (CL0123) HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 13.7)no clan defined STX6_10_61_N; Syntaxin 6/10/61, N-terminal (PF09177; HMM-score: 13.6)HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.4)RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.4)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.1)MarR; MarR family (PF01047; HMM-score: 13)LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by PmtR*, TF important in Hypothetical ABC transporter: see SACOL1997
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8787
- Cytoplasmic Membrane Score: 0.1086
- Cell wall & surface Score: 0.0106
- Extracellular Score: 0.002
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003235
- TAT(Tat/SPI): 0.000192
- LIPO(Sec/SPII): 0.000299
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEHLPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENLVKELVNEAQAIEMSLEELQDILTFIYEEESS
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL1997
- protein localization: see SACOL1997
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: PmtR* see SACOL1997
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]