PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus COL
• locus tag: SACOL_RS10435 [old locus tag: SACOL1997 ]
• pan locus tag^?: SAUPAN005000000
• symbol: SACOL_RS10435
• pan gene symbol^?: pmtR
• synonym:
• product: GntR family transcriptional regulator

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SACOL_RS10435 [old locus tag: SACOL1997 ]
• symbol: SACOL_RS10435
• product: GntR family transcriptional regulator
• replicon: chromosome
• strand: -
• coordinates: 2058311..2058691
• length: 381
• essential: unknown other strains

⊟Accession numbers

• Location: NC_002951 (2058311..2058691) NCBI
• BioCyc: SACOL_RS10435 BioCyc
• MicrobesOnline: see SACOL1997

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  
  ATGAAAATAATTTTAAAAAACAATAGTGATTTTCCGATTTATGAACAGATTAAGCAACAA
  GTAAAACAAAATATTTTAAAGGGACATGTTGCTCCTGGAGAGCATTTGCCGTCAATGAGA
  GAACTTGCCAAAGATCTTCAAGTAAGTTTGATTACTACCAAACGTGCTTATGAAGATTTA
  GAGAAAGACGGTTTTGTTACAACAATTAGAGGAAAAGGGACCTTTGTTAAGGAGCAAGAT
  AGTTCTATTTTAAAAGAGAAACAATTTTTTACCATTGAAAATTTGGTTAAAGAATTGGTT
  AATGAAGCGCAAGCCATCGAAATGTCACTTGAGGAACTGCAGGATATTTTAACGTTCATT
  TATGAGGAGGAATCATCATGA
  60
  120
  180
  240
  300
  360
  381
  

⊟Protein

⊟General

• locus tag: SACOL_RS10435 [old locus tag: SACOL1997 ]
• symbol: SACOL_RS10435
• description: GntR family transcriptional regulator
• length: 126
• theoretical pI: 4.70971
• theoretical MW: 14532.5
• GRAVY: -0.430952

⊟Function

• TIGRFAM:
  Metabolism Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 59.3)
  Signal transduction Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 59.3)
  and 15 more
  Metabolism Transport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 45.2)
  Signal transduction Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 45.2)
  Signal transduction Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 43.6)
  Signal transduction Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 35.1)
  phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 32.7)
  Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.8)
  Metabolism Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
  Metabolism Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
  Signal transduction Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
  Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 13.5)
  putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 13.5)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
  Signal transduction Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 12.8)
  Signal transduction Regulatory functions DNA interactions repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 12.8)
• TheSEED: see SACOL1997
• PFAM:
  HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 64.4)
  and 10 more
  HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 19.3)
  Rrf2; Transcriptional regulator (PF02082; HMM-score: 19.2)
  HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 18.3)
  no clan defined Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.7)
  HTH (CL0123) RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.1)
  MarR_2; MarR family (PF12802; HMM-score: 13)
  MarR; MarR family (PF01047; HMM-score: 12.9)
  LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 12.8)
  HTH_11; HTH domain (PF08279; HMM-score: 12.2)
  HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 12.1)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:
• genes regulated by PmtR*, TF important in Hypothetical ABC transporter: see SACOL1997

⊟Localization

• PSORTb: Cytoplasmic
  • Cytoplasmic Score: 9.97
  • Cytoplasmic Membrane Score: 0
  • Cellwall Score: 0.01
  • Extracellular Score: 0.02
  • Internal Helices: 0
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.003235
  • TAT(Tat/SPI): 0.000192
  • LIPO(Sec/SPII): 0.000299
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 446614238 NCBI
• RefSeq: WP_000691584 NCBI
• UniProt: see SACOL1997

⊟Protein sequence

• MKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEHLPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENLVKELVNEAQAIEMSLEELQDILTFIYEEESS

⊟Experimental data

• experimentally validated: see SACOL1997
• protein localization: see SACOL1997
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator: PmtR* see SACOL1997

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications