From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10520
  • pan locus tag?:
  • symbol: SACOL_RS10520
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS10520
  • symbol: SACOL_RS10520
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2075110..2075322
  • length: 213
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (2075110..2075322) NCBI
  • BioCyc: SACOL_RS10520 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGACAGACGATAATGTCAATGATCATATTATAAAGAATCACATAGAAATGATTGTTGAC
    AGATTAGCGACCGATAAAGAGTTTTATATTTTTGACTCCCTTATACAAGGACTTAGTTAT
    CAAGATATTAGTAGTGCCTTAGATTGTTCAGAACAATCTGTAATATTATGGTATGAAACC
    ATATTAGATAAAATTGTGGGGGTGATAAAATGA
    60
    120
    180
    213

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS10520
  • symbol: SACOL_RS10520
  • description: hypothetical protein
  • length: 70
  • theoretical pI: 4.06289
  • theoretical MW: 8077.13
  • GRAVY: 0.0471429

Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 19)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 15.4)
    and 4 more
    RNA polymerase sigma factor RpoE (TIGR02939; HMM-score: 13.2)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 13.1)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 13.1)
    RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 12.4)
  • TheSEED:
  • PFAM:
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 22.4)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 18.6)
    and 1 more
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003751
    • TAT(Tat/SPI): 0.000247
    • LIPO(Sec/SPII): 0.000511
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446051043 NCBI
  • RefSeq: WP_000128898 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MTDDNVNDHIIKNHIEMIVDRLATDKEFYIFDSLIQGLSYQDISSALDCSEQSVILWYETILDKIVGVIK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]