From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11090 [old locus tag: SACOL2120 ]
  • pan locus tag?: SAUPAN005422000
  • symbol: SACOL_RS11090
  • pan gene symbol?: rpoE
  • synonym:
  • product: DNA-directed RNA polymerase subunit delta

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS11090 [old locus tag: SACOL2120 ]
  • symbol: SACOL_RS11090
  • product: DNA-directed RNA polymerase subunit delta
  • replicon: chromosome
  • strand: -
  • coordinates: 2181281..2181811
  • length: 531
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (2181281..2181811) NCBI
  • BioCyc: G1G4B-2330 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAAATTCAAGATTATACAAAACAAATGGTTGATGAAAAATCATTTATTGATATGGCT
    TATACATTATTGAATGATAAAGGCGAAACAATGAACTTATATGATATCATCGATGAATTT
    AGAGCGTTAGGTGATTATGAGTACGAAGAAATTGAAAATCGTGTTGTACAATTTTACACG
    GATTTAAACACAGATGGTCGTTTTTTAAATGTTGGAGAAAATTTATGGGGATTACGTGAT
    TGGTATTCGGTAGATGATATTGAAGAGAAAATCGCACCAACTATTCAAAAATTCGATATT
    CTGGATGCAGATGATGAAGAAGATCAAAACTTAAAATTATTGGGCGAAGATGAAATGGAT
    GACGACGATGATATTCCAGCTCAAACAGATGATCAAGAAGAACTAAATGATCCAGAAGAT
    GAGCAGGTTGAAGAAGAAATCAATCATTCGGATATAGTCATTGAAGAAGATGAAGATGAA
    CTAGACGAAGACGAAGAAGTGTTTGAAGACGAAGAAGACTTCAACGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    531

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS11090 [old locus tag: SACOL2120 ]
  • symbol: SACOL_RS11090
  • description: DNA-directed RNA polymerase subunit delta
  • length: 176
  • theoretical pI: 3.36108
  • theoretical MW: 20881
  • GRAVY: -1.0483

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase delta subunit (TIGR04567; EC 2.7.7.6; HMM-score: 105.4)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HARE-HTH; HB1, ASXL, restriction endonuclease HTH domain (PF05066; HMM-score: 36.9)
    and 1 more
    no clan defined TFIIA; Transcription factor IIA, alpha/beta subunit (PF03153; HMM-score: 6.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SACOL_RS03050DNA-directed RNA polymerase subunit beta  [1] (data from MRSA252)
    SACOL_RS03055DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SACOL_RS05630pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SACOL_RS05635pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SACOL_RS05640dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SACOL_RS05645dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SACOL_RS07385dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    SACOL_RS073902-oxoglutarate dehydrogenase E1 component  [1] (data from MRSA252)
    SACOL_RS08345molecular chaperone DnaK  [1] (data from MRSA252)
    SACOL_RS0868050S ribosomal protein L21  [1] (data from MRSA252)
    SACOL_RS0882050S ribosomal protein L20  [1] (data from MRSA252)
    SACOL_RS1176550S ribosomal protein L2  [1] (data from MRSA252)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004767
    • TAT(Tat/SPI): 0.000217
    • LIPO(Sec/SPII): 0.001088
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446624137 NCBI
  • RefSeq: WP_000701483 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYTDLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMDDDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]