From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11185 [old locus tag: SACOL2137 ]
  • pan locus tag?: SAUPAN005443000
  • symbol: SACOL_RS11185
  • pan gene symbol?: czrA
  • synonym:
  • product: transcriptional regulator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS11185 [old locus tag: SACOL2137 ]
  • symbol: SACOL_RS11185
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2198282..2198602
  • length: 321
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (2198282..2198602) NCBI
  • BioCyc: SACOL_RS11185 BioCyc
  • MicrobesOnline: see SACOL2137

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTCAGAACAATATTCAGAAATAAATACAGATACATTAGAACGCGTAACTGAAATTTTC
    AAGGCATTAGGCGATTACAATCGAATACGTATCATGGAATTGTTATCAGTCAGCGAAGCA
    AGTGTTGGTCACATTTCACATCAATTGAATTTATCTCAATCAAATGTCTCGCACCAATTA
    AAATTACTTAAAAGTGTGCATCTTGTGAAAGCAAAACGACAAGGCCAATCAATGATTTAT
    TCATTAGATGACATCCACGTAGCAACTATGTTAAAGCAAGCCATACATCACGCGAATCAT
    CCTAAAGAAAGTGGGTTATAA
    60
    120
    180
    240
    300
    321

⊟Protein[edit | edit source]

Protein Data Bank: 4GGG

⊟General[edit | edit source]

  • locus tag: SACOL_RS11185 [old locus tag: SACOL2137 ]
  • symbol: SACOL_RS11185
  • description: transcriptional regulator
  • length: 106
  • theoretical pI: 8.01089
  • theoretical MW: 11988.6
  • GRAVY: -0.336792

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 25.7)
    and 3 more
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.2)
    Metabolism Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 13.4)
    Signal transduction Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 13.4)
  • TheSEED: see SACOL2137
  • PFAM:
    HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 40.2)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 35.9)
    and 9 more
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 19.9)
    Vps51 (CL0295) Sec8_exocyst; Sec8 exocyst complex component specific domain (PF04048; HMM-score: 17.1)
    HTH (CL0123) TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.7)
    no clan defined DUF4423; Domain of unknown function (DUF4423) (PF14394; HMM-score: 15.4)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.7)
    MarR_2; MarR family (PF12802; HMM-score: 13.9)
    TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 13.8)
    HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 13.6)
    HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 13.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by CzrA, TF important in Zinc resistance: see SACOL2137

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003189
    • TAT(Tat/SPI): 0.000432
    • LIPO(Sec/SPII): 0.000309
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL

⊟Experimental data[edit | edit source]

  • experimentally validated: see SACOL2137
  • protein localization: see SACOL2137
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL_RS11185&oldid=92068"