Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS11535 [old locus tag: SACOL2193 ]
- pan locus tag?: SAUPAN005608000
- symbol: SACOL_RS11535
- pan gene symbol?: —
- synonym:
- product: MerR family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS11535 [old locus tag: SACOL2193 ]
- symbol: SACOL_RS11535
- product: MerR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2273402..2273818
- length: 417
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
GAAAAGGTTGGTGTGATTCCACCAGTTAATCGAGATGAAAATGGATATAGAATATATAAT
GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
GAATCGCTTATCGAATTTTGCAGGTTAGCGCAGCTTCCTAAAAATGAAAATATTCAAGCA
CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
CATGATGCGAGAGATTTACTACAATATAAAATTGATAATTATGATAATCATATTGCTAAA
ATCAATGCTAGTGATAATTATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA60
120
180
240
300
360
417
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS11535 [old locus tag: SACOL2193 ]
- symbol: SACOL_RS11535
- description: MerR family transcriptional regulator
- length: 138
- theoretical pI: 5.29007
- theoretical MW: 16340.3
- GRAVY: -0.781159
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 63.8)Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 59.8)and 5 moreRegulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 44.8)Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43.3)Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43.3)Cellular processes Detoxification mercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 29.7)Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
- TheSEED: see SACOL2193
- PFAM: HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.5)MerR; MerR family regulatory protein (PF00376; HMM-score: 49.2)and 6 moreMerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 17)no clan defined SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 15.1)HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 15.1)Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 13.3)PDDEXK (CL0236) Dna2; DNA replication factor Dna2 (PF08696; HMM-score: 12.8)no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014504
- TAT(Tat/SPI): 0.000174
- LIPO(Sec/SPII): 0.001416
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDARDLLQYKIDNYDNHIAKINASDNYDDNVERLWERK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY see SACOL2193
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.