From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12940 [old locus tag: SACOL2467 ]
  • pan locus tag?: SAUPAN006016000
  • symbol: SACOL_RS12940
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS12940 [old locus tag: SACOL2467 ]
  • symbol: SACOL_RS12940
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2524251..2524706
  • length: 456
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (2524251..2524706) NCBI
  • BioCyc: G1G4B-2709 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAAAAAATTATGTTCATTAATTGTAGTAGCATTAGTTTGTATCATTGCATTATCAGCT
    TGTGGTAAAGAACAAACCAAAACATATGAAGGTGATGTTAGTGGTAAACATGTACTAACT
    TCTATCACATATAAAGATGATAAAGTTTTAAAACAGTCTACAATCAACACAATTAAATAT
    GACGATCTAGGTATGGATAAAGACGAAGCCAAAAAGTTATTCGCCAAATCTGAAAGTATT
    TTCAAAGACCTTAAAGGCGTAAAATACAAAGTAGACTATAAAGATAAAAAAGCAATTGAA
    CACTTAGACATAGATTACACAGAAGTTGACATGAAAAAATTAAATAAACGTCTTGGTGTT
    TCGACTAAAGAAAATAAAGATATTAGTTTTGAAAAACTTGAAAAGCAATTAAAGCACAGA
    GGTTTAAAAGAAAAAGATAAAATGGACGACAAATAG
    60
    120
    180
    240
    300
    360
    420
    456

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS12940 [old locus tag: SACOL2467 ]
  • symbol: SACOL_RS12940
  • description: hypothetical protein
  • length: 151
  • theoretical pI: 9.59597
  • theoretical MW: 17311.1
  • GRAVY: -0.688742

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Amino acids, peptides and amines lipoprotein, PulS/OutS family (TIGR01004; HMM-score: 13.1)
  • TheSEED:
  • PFAM:
    no clan defined DUF1307; Protein of unknown function (DUF1307) (PF06998; HMM-score: 127.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 20 aa
    • SP(Sec/SPI): 0.000919
    • TAT(Tat/SPI): 0.000039
    • LIPO(Sec/SPII): 0.998908
    • Cleavage Site: CS pos: 20-21. LSA-CG. Pr: 0.9992
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446654736 NCBI
  • RefSeq: WP_000732082 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKKLCSLIVVALVCIIALSACGKEQTKTYEGDVSGKHVLTSITYKDDKVLKQSTINTIKYDDLGMDKDEAKKLFAKSESIFKDLKGVKYKVDYKDKKAIEHLDIDYTEVDMKKLNKRLGVSTKENKDISFEKLEKQLKHRGLKEKDKMDDK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]