From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13560 [old locus tag: SACOL2589 ]
  • pan locus tag?: SAUPAN006245000
  • symbol: SACOL_RS13560
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS13560 [old locus tag: SACOL2589 ]
  • symbol: SACOL_RS13560
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2653012..2653242
  • length: 231
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2653012..2653242) NCBI
  • BioCyc: SACOL_RS13560 BioCyc
  • MicrobesOnline: see SACOL2589

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAAATTTTAGATAGAATTAATGAACTTGCAAATAAAGAAAAAGTACAACCACTTACT
    GTAGCTGAAAAACAAGAACAACATGCATTGCGTCAAGACTACTTAAGCATGATCCGAGGA
    CAAGTATTAACAACATTTTCCACAATAAAAGTGGTTGATCCAATCGGTCAGGATGTCACA
    CCAGATAAAGTTTATGATCTTCGCCAACAATACGGTTATATTCAAAATTAA
    60
    120
    180
    231

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS13560 [old locus tag: SACOL2589 ]
  • symbol: SACOL_RS13560
  • description: hypothetical protein
  • length: 76
  • theoretical pI: 7.51939
  • theoretical MW: 8834.06
  • GRAVY: -0.564474

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL2589
  • PFAM:
    no clan defined DUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 87.3)
    and 1 more
    DUF4113; Domain of unknown function (DUF4113) (PF13438; HMM-score: 15.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9937
    • Cytoplasmic Membrane Score: 0.0038
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0025
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004095
    • TAT(Tat/SPI): 0.000869
    • LIPO(Sec/SPII): 0.000771
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKILDRINELANKEKVQPLTVAEKQEQHALRQDYLSMIRGQVLTTFSTIKVVDPIGQDVTPDKVYDLRQQYGYIQN

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: see SACOL2589
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]