Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS14435 [old locus tag: SACOL0258 ]
- pan locus tag?: SAUPAN001158000
- symbol: SACOL_RS14435
- pan gene symbol?: —
- synonym:
- product: NADH dehydrogenase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS14435 [old locus tag: SACOL0258 ]
- symbol: SACOL_RS14435
- product: NADH dehydrogenase
- replicon: chromosome
- strand: +
- coordinates: 297444..297623
- length: 180
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGAGACGAGAGAATATATTATTAAGGTTAATACCTTTTAATGATTATGATAACAAGAAT
TTTAAAATGTTTATTGTGATTAAAAATACAAAAGTCATTATTTTAAAGAATAAAATATTT
GTTTTTGAACAAAGTATTAAAAAACATAACGAAATGATGTATATTGAACTATGTGATTGA60
120
180
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS14435 [old locus tag: SACOL0258 ]
- symbol: SACOL_RS14435
- description: NADH dehydrogenase
- length: 59
- theoretical pI: 10.0226
- theoretical MW: 7294.74
- GRAVY: -0.167797
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL0258
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRRENILLRLIPFNDYDNKNFKMFIVIKNTKVIILKNKIFVFEQSIKKHNEMMYIELCD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available