Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS14455 [old locus tag: SACOL0390 ]
- pan locus tag?: SAUPAN001849000
- symbol: SACOL_RS14455
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS14455 [old locus tag: SACOL0390 ]
- symbol: SACOL_RS14455
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 398250..398408
- length: 159
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATCATACAAGGATGGGATCATGTCGATTTTATCGGTGTGGACTTCCTGGATTTCAAACGT
AAAGGTGCAGAACTTGCCAACTTCTATACAGGTATTATAAATGACTTGTTGCGTGTTGAA
GCGACTGAAAGTAAAGGAACACAATTGAAAGCAAGTTAA60
120
159
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS14455 [old locus tag: SACOL0390 ]
- symbol: SACOL_RS14455
- description: hypothetical protein
- length: 52
- theoretical pI: 4.8445
- theoretical MW: 5859.61
- GRAVY: -0.15
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.09
- Cellwall Score: 0.18
- Extracellular Score: 9.72
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.4904
- Cytoplasmic Membrane Score: 0.1609
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.3485
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012099
- TAT(Tat/SPI): 0.001499
- LIPO(Sec/SPII): 0.002859
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQGWDHVDFIGVDFLDFKRKGAELANFYTGIINDLLRVEATESKGTQLKAS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]