From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00685
  • pan locus tag?: SAUPAN002561000
  • symbol: SAOUHSC_00685
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00685
  • symbol: SAOUHSC_00685
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 671375..671770
  • length: 396
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAGAAATTAATCATCAGTATTATGGCGGTCATGCTATTTTTAACAGGTTGTGGTAAA
    AGTCAAGAGAAAGCCACTCTGGAAAAGGATATCGATAATTTACAAAAAGAAAATAAAGAA
    TTAAAAGACAAAAAAGAAAAGCTTCAACAAGAAAAAGAAAAATTAGCAGATAAGCAAAAA
    GACCTTGAAAAAGAAGTGAAAGATTTAAAACCTTCAAAAGAAGATAACAAGGATGATAAA
    AAAGACGAAGACAAAAATAAAGACAAAGATAAAGATAAAGAGGCATCACAAGATAAGCAA
    TCAAAAGATCAAACTAAGTCATCGGATAAAGATAATCACAAAAAGCCTACATCAGCAGAT
    AAAGATCAAAAAGCTAATGACAAACACCAATCATAA
    60
    120
    180
    240
    300
    360
    396


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00685
  • symbol: SAOUHSC_00685
  • description: hypothetical protein
  • length: 131
  • theoretical pI: 9.36324
  • theoretical MW: 15188
  • GRAVY: -1.87863

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 19.6)
    Signal transduction Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 19.6)
    Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 19.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 16.7)
    and 14 more
    SH3 domain protein (TIGR04211; HMM-score: 9.6)
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 7.9)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 5.7)
    type IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 5.5)
    Genetic information processing Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 5.5)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)
    Cellular processes Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 5.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 5.1)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 4.2)
    Cellular processes Cellular processes Cell division cell division protein FtsN (TIGR02223; HMM-score: 4.1)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AE (TIGR02829; HMM-score: 3.2)
  • TheSEED  :
    • FIG01108219: hypothetical protein
  • PFAM:
    no clan defined TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 18.9)
    and 16 more
    Striatin; Striatin family (PF08232; HMM-score: 12.7)
    Leu_zip; Leucine zipper (PF15294; HMM-score: 12.5)
    Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 10.9)
    DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 10.3)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 10.2)
    BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 10.2)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 10)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 9.5)
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 9.4)
    no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 9.1)
    NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 8.5)
    YabA; Initiation control protein YabA (PF06156; HMM-score: 7.5)
    APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 7.3)
    Snu56_snRNP; Snu56-like U1 small nuclear ribonucleoprotein component (PF19097; HMM-score: 7.3)
    PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 7.1)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 6.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9446
    • Cell wall & surface Score: 0.0119
    • Extracellular Score: 0.0434
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LFLTGCG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000361
    • TAT(Tat/SPI): 0.000046
    • LIPO(Sec/SPII): 0.999389
    • Cleavage Site: CS pos: 17-18. LTG-CG. Pr: 0.9999
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQKDLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSADKDQKANDKHQS

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]