Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00685
- pan locus tag?: SAUPAN002561000
- symbol: SAOUHSC_00685
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_00685
- symbol: SAOUHSC_00685
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 671375..671770
- length: 396
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920989 NCBI
- RefSeq: YP_499244 NCBI
- BioCyc: G1I0R-639 BioCyc
- MicrobesOnline: 1289154 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAGAAATTAATCATCAGTATTATGGCGGTCATGCTATTTTTAACAGGTTGTGGTAAA
AGTCAAGAGAAAGCCACTCTGGAAAAGGATATCGATAATTTACAAAAAGAAAATAAAGAA
TTAAAAGACAAAAAAGAAAAGCTTCAACAAGAAAAAGAAAAATTAGCAGATAAGCAAAAA
GACCTTGAAAAAGAAGTGAAAGATTTAAAACCTTCAAAAGAAGATAACAAGGATGATAAA
AAAGACGAAGACAAAAATAAAGACAAAGATAAAGATAAAGAGGCATCACAAGATAAGCAA
TCAAAAGATCAAACTAAGTCATCGGATAAAGATAATCACAAAAAGCCTACATCAGCAGAT
AAAGATCAAAAAGCTAATGACAAACACCAATCATAA60
120
180
240
300
360
396
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00685
- symbol: SAOUHSC_00685
- description: hypothetical protein
- length: 131
- theoretical pI: 9.36324
- theoretical MW: 15188
- GRAVY: -1.87863
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 19.6)Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 19.6)Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 19.4)Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 16.7)and 14 moreSH3 domain protein (TIGR04211; HMM-score: 9.6)Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 7.9)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 5.7)type IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 5.5)Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 5.5)Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 5.1)Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 5.1)Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 4.2)Cellular processes Cell division cell division protein FtsN (TIGR02223; HMM-score: 4.1)Cellular processes Sporulation and germination stage III sporulation protein AE (TIGR02829; HMM-score: 3.2)
- TheSEED :
- FIG01108219: hypothetical protein
- PFAM: no clan defined TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 18.9)and 16 moreStriatin; Striatin family (PF08232; HMM-score: 12.7)Leu_zip; Leucine zipper (PF15294; HMM-score: 12.5)Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 10.9)DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 10.3)FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 10.2)BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 10.2)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 10)GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 9.5)AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 9.4)no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 9.1)NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 8.5)YabA; Initiation control protein YabA (PF06156; HMM-score: 7.5)APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 7.3)Snu56_snRNP; Snu56-like U1 small nuclear ribonucleoprotein component (PF19097; HMM-score: 7.3)PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 7.1)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 6.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9446
- Cell wall & surface Score: 0.0119
- Extracellular Score: 0.0434
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: 0
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: LFLTGCG
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000361
- TAT(Tat/SPI): 0.000046
- LIPO(Sec/SPII): 0.999389
- Cleavage Site: CS pos: 17-18. LTG-CG. Pr: 0.9999
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQKDLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSADKDQKANDKHQS
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
