NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01653
- pan locus tag?: SAUPAN004134000
- symbol: SAOUHSC_01653
- pan gene symbol?: sodA
- synonym:
- product: superoxide dismutase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01653
- symbol: SAOUHSC_01653
- product: superoxide dismutase
- replicon: chromosome
- strand: -
- coordinates: 1567139..1567738
- length: 600
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920105 NCBI
- RefSeq: YP_500165 NCBI
- BioCyc: G1I0R-1537 BioCyc
- MicrobesOnline: 1290079 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGGCTTTTGAATTACCAAAATTACCATACGCATTTGATGCATTAGAACCACATTTTGAC
AAAGAAACTATGGAAATTCACCATGACAGACATCATAACACGTATGTTACGAAATTAAAT
GCTGCAGTAGAAGGTACAGATTTAGAATCTAAATCTATTGAAGAAATTGTTGCTAATTTA
GACAGTGTACCAGCTAACATCCAAACTGCTGTACGTAATAATGGCGGTGGACATTTAAAC
CATTCATTATTCTGGGAGTTACTTTCACCAAACTCAGAAGAAAAAGGTACTGTAGTAGAA
AAAATTAAAGAACAATGGGGTTCTTTAGAAGAATTTAAAAAAGAATTTGCTGACAAAGCA
GCTGCACGCTTTGGTTCAGGTTGGGCTTGGTTAGTCGTAAACAATGGCCAGTTAGAAATT
GTGACTACACCAAACCAAGATAATCCATTAACTGAGGGTAAAACACCTATTTTAGGTTTA
GACGTATGGGAACACGCTTATTACCTAAAATATCAAAACAAACGCCCTGACTACATTGGC
GCATTTTGGAATGTAGTTAACTGGGAAAAAGTTGACGAATTATATAATGCAACAAAATAA60
120
180
240
300
360
420
480
540
600
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01653
- symbol: SAOUHSC_01653
- description: superoxide dismutase
- length: 199
- theoretical pI: 4.8565
- theoretical MW: 22711.2
- GRAVY: -0.575879
⊟Function[edit | edit source]
- reaction: EC 1.15.1.1? ExPASySuperoxide dismutase 2 superoxide + 2 H+ = O2 + H2O2
- TIGRFAM:
- TheSEED :
- Superoxide dismutase [Fe] (EC 1.15.1.1)
- Superoxide dismutase [Mn] (EC 1.15.1.1)
Nitrogen Metabolism Nitrogen Metabolism - no subcategory Nitric oxide synthase Manganese superoxide dismutase (EC 1.15.1.1)and 5 more - PFAM: no clan defined Sod_Fe_C; Iron/manganese superoxide dismutases, C-terminal domain (PF02777; HMM-score: 144.2)Sod_Fe_N; Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081; HMM-score: 119.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Mn2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.09
- Cellwall Score: 0.18
- Extracellular Score: 9.72
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002208
- TAT(Tat/SPI): 0.0003
- LIPO(Sec/SPII): 0.000241
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKAAARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKVDELYNATK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY* (repression) regulon
CodY* (TF) important in Amino acid metabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
M O Clements, S P Watson, S J Foster
Characterization of the major superoxide dismutase of Staphylococcus aureus and its role in starvation survival, stress resistance, and pathogenicity.
J Bacteriol: 1999, 181(13);3898-903
[PubMed:10383955] [WorldCat.org] [DOI] (P p)M W Valderas, M E Hart
Identification and characterization of a second superoxide dismutase gene (sodM) from Staphylococcus aureus.
J Bacteriol: 2001, 183(11);3399-407
[PubMed:11344148] [WorldCat.org] [DOI] (P p)Michelle Wright Valderas, Joshua W Gatson, Natalie Wreyford, Mark E Hart
The superoxide dismutase gene sodM is unique to Staphylococcus aureus: absence of sodM in coagulase-negative staphylococci.
J Bacteriol: 2002, 184(9);2465-72
[PubMed:11948161] [WorldCat.org] [DOI] (P p)Michail H Karavolos, Malcolm J Horsburgh, Eileen Ingham, Simon J Foster
Role and regulation of the superoxide dismutases of Staphylococcus aureus.
Microbiology (Reading): 2003, 149(Pt 10);2749-2758
[PubMed:14523108] [WorldCat.org] [DOI] (P p)Sami Maalej, Ines Dammak, Sam Dukan
The impairment of superoxide dismutase coordinates the derepression of the PerR regulon in the response of Staphylococcus aureus to HOCl stress.
Microbiology (Reading): 2006, 152(Pt 3);855-861
[PubMed:16514164] [WorldCat.org] [DOI] (P p)