From AureoWiki
Jump to navigation Jump to search
04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01761a
  • pan locus tag?:
  • symbol: SAOUHSC_01761a
  • pan gene symbol?:
  • synonym:
  • product: membrane protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01761a
  • symbol: SAOUHSC_01761a
  • product: membrane protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1662066..1662263
  • length: 198
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID: 16830702 NCBI
  • RefSeq: YP_008530242 NCBI
  • BioCyc: G1I0R-1635 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGAGTATACTAACAATTATTTTAATAGCACTATTAGTCATCCTCCTTTTTAGAGTTGGA
    CTTTCTATTTTGCGATTTTTAATTTATGTCGGACTTGTTTTATTATGTATTTACTTAGGA
    TATCAAGGTTTAATTTGGTTGCTCGATTTTTTTCAAATAAATAGTGGATTTTTACCGCAC
    TTTCAATTTAACAATTAA
    60
    120
    180
    198

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01761a
  • symbol: SAOUHSC_01761a
  • description: membrane protein
  • length: 65
  • theoretical pI: 8.49514
  • theoretical MW: 7517.2
  • GRAVY: 1.6

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    FIG01108105: hypothetical protein
  • PFAM:
    no clan defined Reticulon; Reticulon (PF02453; HMM-score: 11.1)
    DUF3985; Protein of unknown function (DUF3985) (PF13153; HMM-score: 11)
    and 1 more
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 6.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00169
    • TAT(Tat/SPI): 0.000231
    • LIPO(Sec/SPII): 0.023387
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

  • GI: 542123275 NCBI
  • RefSeq: YP_008530242 NCBI
  • UniProt:
  • STRING:

Protein sequence[edit | edit source]

  • MSILTIILIALLVILLFRVGLSILRFLIYVGLVLLCIYLGYQGLIWLLDFFQINSGFLPHFQFNN

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]