From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01872
  • pan locus tag?: SAUPAN004433000
  • symbol: SAOUHSC_01872
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01872
  • symbol: SAOUHSC_01872
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1780197..1781465
  • length: 1269
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    ATGTATCAAACAATTATTATCGGAGGCGGACCTAGCGGCTTAATGGCGGCAGTAGCTGCA
    AGCGAACAAAGTAGCAGTGTGTTACTCATTGAAAAAAAGAAAGGTCTAGGTCGTAAACTC
    AAAATATCTGGTGGCGGTAGATGTAACGTAACTAATCGATTACCATATGCTGAAATTATT
    AAGAACATTCCTGGAAATGGGAAATTTTTATATAGTCCCTTTTCAATTTTTGATAATGAA
    TCCATCATAGATTTTTTTGAGTCTAGGGGTGTTAAATTAAAAGAAGAAGATCACGGGCGT
    ATGTTTCCAGTTTCCAACAAAGCACAAGACGTGGTTGATACATTAGTGACAACTATCGAA
    CGCCAACATGTAACGATTAAAGAAGAAGAAGCTGTTAGTAGAATCGAAGTTAATACAGAC
    CAAACTTTCACTGTACATACTCAAAATAATAGTTATGAAAGCCATTCGCTAGTGATTGCT
    ACAGGTGGTACAAGTGTCCCTCAAACTGGTTCAACTGGTGATGGTTATAAGTTCGCACAA
    GATTTAGGTCATACCATTACTGAGTTATTCCCGACCGAAGTTCCAATTACATCAGCTGAA
    CCTTTCATCAAATCCAATCGTCTAAAAGGTTTAAGTTTAAAAGATGTTGAATTGTCAGTA
    CTTAAGAAAAATGGTAAAAAACGCATCAGTCATCAAATGGATATGTTATTTACTCATTTT
    GGTATCAGTGGTCCAGCTGCATTAAGATGTAGTCAGTTTGTTTATAAAGAACAAAAAAAT
    CAAAAGACACAGCACATTTCTATGGCAATCGATGCATTTCCTGAATTAAACCATGAACAA
    TTAAAACAACACATCACATCATTATTATCGGACACACCAGATAAAATCATTAAAAACAGT
    TTGCATGGTCTAATTGAAGAGCGCTACTTACTGTTCATGCTGGAACAAGCAGGAATCGAT
    GAAAATACCACATCACATCACTTATCAAATCAACAATTGAACGACTTAGTAAATATGTTT
    AAAGGGTTTGTATTTAAGGTGAACGGGACATTACCTATAGATAAGGCATTTGTCACAGGT
    GGTGGTGTGTCACTTAAAGAAATTCAACCTAAAACAATGATGTCTAAATTAGTTCCGGGA
    TTATTTTTATGTGGTGAAGTATTAGATATACATGGTTATACTGGTGGTTATAATATTACA
    AGTGCACTCGTAACAGGACATGTCGCTGGATTATATGCCGGACATTACTCACATGCATCA
    ATGGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1269

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01872
  • symbol: SAOUHSC_01872
  • description: hypothetical protein
  • length: 422
  • theoretical pI: 7.3187
  • theoretical MW: 46415.7
  • GRAVY: -0.228199

Function[edit | edit source]

  • TIGRFAM:
    Unknown function Enzymes of unknown specificity flavoprotein, HI0933 family (TIGR00275; HMM-score: 478.6)
    and 36 more
    flavoprotein, TIGR03862 family (TIGR03862; HMM-score: 130.4)
    Unknown function Enzymes of unknown specificity putative bacillithiol system oxidoreductase, YpdA family (TIGR04018; EC 1.8.-.-; HMM-score: 38.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll geranylgeranyl reductase family (TIGR02032; EC 1.3.1.-; HMM-score: 35.5)
    Metabolism Energy metabolism Electron transport thioredoxin-disulfide reductase (TIGR01292; EC 1.8.1.9; HMM-score: 34.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin 3B synthase CobZ (TIGR02485; HMM-score: 33.9)
    dihydrolipoyl dehydrogenase (TIGR01350; EC 1.8.1.4; HMM-score: 32.3)
    putative alkyl hydroperoxide reductase F subunit (TIGR03143; EC 1.6.4.-; HMM-score: 24.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pyridine nucleotides L-aspartate oxidase (TIGR00551; EC 1.4.3.16; HMM-score: 23.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine glycine oxidase ThiO (TIGR02352; EC 1.4.3.19; HMM-score: 22.4)
    squalene-associated FAD-dependent desaturase (TIGR03467; HMM-score: 22.4)
    mycofactocin system FadH/OYE family oxidoreductase 2 (TIGR03997; EC 1.-.-.-; HMM-score: 22.4)
    flavin-dependent oxidoreductase, MSMEG_0569 family (TIGR04046; HMM-score: 21.9)
    Cellular processes Cellular processes Detoxification mercury(II) reductase (TIGR02053; EC 1.16.1.1; HMM-score: 20.2)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain (TIGR03197; HMM-score: 20)
    Metabolism Energy metabolism TCA cycle succinate dehydrogenase or fumarate reductase, flavoprotein subunit (TIGR01812; HMM-score: 19.4)
    Metabolism Energy metabolism Anaerobic succinate dehydrogenase or fumarate reductase, flavoprotein subunit (TIGR01812; HMM-score: 19.4)
    Metabolism Energy metabolism Aerobic succinate dehydrogenase or fumarate reductase, flavoprotein subunit (TIGR01812; HMM-score: 19.4)
    Metabolism Energy metabolism Amino acids and amines sarcosine oxidase, alpha subunit family (TIGR01372; HMM-score: 18.5)
    Metabolism Energy metabolism Electron transport glutathione-disulfide reductase (TIGR01421; EC 1.8.1.7; HMM-score: 18.4)
    Metabolism Energy metabolism Electron transport flavocytochrome c (TIGR01813; HMM-score: 18.1)
    Metabolism Energy metabolism Amino acids and amines sarcosine oxidase, monomeric form (TIGR01377; HMM-score: 17.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 2-polyprenyl-6-methoxyphenol 4-hydroxylase (TIGR01984; EC 1.14.13.-; HMM-score: 15)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family (TIGR01988; EC 1.14.13.-; HMM-score: 14.7)
    Cellular processes Cellular processes Detoxification alkyl hydroperoxide reductase subunit F (TIGR03140; EC 1.8.1.-; HMM-score: 14.6)
    Cellular processes Cellular processes Adaptations to atypical conditions alkyl hydroperoxide reductase subunit F (TIGR03140; EC 1.8.1.-; HMM-score: 14.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine thiazole biosynthesis enzyme (TIGR00292; HMM-score: 14.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll geranylgeranyl reductase (TIGR02023; EC 1.3.1.-; HMM-score: 14)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-galactopyranose mutase (TIGR00031; EC 5.4.99.9; HMM-score: 13.6)
    thioredoxin and glutathione reductase (TIGR01438; EC 1.6.4.-; HMM-score: 13.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other C-3',4' desaturase CrtD (TIGR02733; EC 1.3.99.-; HMM-score: 13.4)
    Metabolism Energy metabolism Anaerobic glycerol-3-phosphate dehydrogenase, anaerobic, B subunit (TIGR03378; EC 1.1.5.3; HMM-score: 12.1)
    mycofactocin system FadH/OYE family oxidoreductase 1 (TIGR03996; EC 1.-.-.-; HMM-score: 11.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other phytoene desaturase (TIGR02734; EC 1.14.99.-; HMM-score: 11)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (TIGR00136; HMM-score: 10.6)
    Unknown function Enzymes of unknown specificity GMC family mycofactocin-associated oxidreductase (TIGR04542; EC 1.-.-.-; HMM-score: 9.7)
    lycopene cyclase family protein (TIGR01790; HMM-score: 8.8)
  • TheSEED:  
    NAD(FAD)-utilizing dehydrogenases
  • PFAM:
    NADP_Rossmann (CL0063) HI0933_like; HI0933-like protein (PF03486; HMM-score: 519.3)
    and 12 more
    Pyr_redox_3; Pyridine nucleotide-disulphide oxidoreductase (PF13738; HMM-score: 51.1)
    Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 36.6)
    FAD_binding_2; FAD binding domain (PF00890; HMM-score: 34.6)
    DAO; FAD dependent oxidoreductase (PF01266; HMM-score: 29.7)
    GIDA; Glucose inhibited division protein A (PF01134; HMM-score: 28.1)
    FAD_oxidored; FAD dependent oxidoreductase (PF12831; HMM-score: 27.3)
    NAD_binding_8; NAD(P)-binding Rossmann-like domain (PF13450; HMM-score: 23)
    NAD_binding_9; FAD-NAD(P)-binding (PF13454; HMM-score: 22.3)
    Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 20.5)
    FAD_binding_3; FAD binding domain (PF01494; HMM-score: 16.5)
    Thi4; Thi4 family (PF01946; HMM-score: 13.6)
    Trp_halogenase; Tryptophan halogenase (PF04820; HMM-score: 13.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.124651
    • TAT(Tat/SPI): 0.01998
    • LIPO(Sec/SPII): 0.070645
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MYQTIIIGGGPSGLMAAVAASEQSSSVLLIEKKKGLGRKLKISGGGRCNVTNRLPYAEIIKNIPGNGKFLYSPFSIFDNESIIDFFESRGVKLKEEDHGRMFPVSNKAQDVVDTLVTTIERQHVTIKEEEAVSRIEVNTDQTFTVHTQNNSYESHSLVIATGGTSVPQTGSTGDGYKFAQDLGHTITELFPTEVPITSAEPFIKSNRLKGLSLKDVELSVLKKNGKKRISHQMDMLFTHFGISGPAALRCSQFVYKEQKNQKTQHISMAIDAFPELNHEQLKQHITSLLSDTPDKIIKNSLHGLIEERYLLFMLEQAGIDENTTSHHLSNQQLNDLVNMFKGFVFKVNGTLPIDKAFVTGGGVSLKEIQPKTMMSKLVPGLFLCGEVLDIHGYTGGYNITSALVTGHVAGLYAGHYSHASME

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAOUHSC_01872 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]