From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02090
  • pan locus tag?: SAUPAN004862000
  • symbol: SAOUHSC_02090
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02090
  • symbol: SAOUHSC_02090
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1966974..1968119
  • length: 1146
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGCGTAATAACAAGCCTAAAATAAGTATTCAAAACGACCCATGGGAAGCATATAACGAT
    GTTAAAGAACATGGCCAATTAACTTTAAGTAACATCGAATTTACAACTACAAATCTTTGT
    AATATGCGTTGTAGCCACTGTGCAGTTGGTTATACTTTACAAACTGTCGACCCCGAGCCT
    TTAGATATGGACTTAATTTATCGTAGACTTGATGAAATTCCAAATCTGCGAACGATGTCT
    ATTACAGGTGGCGAACCAATGTTTTCTAAAAAGTCTATTAGAAATGTTGTTAAACCTCTA
    TTAAAGTATGCACATCATCGAGGTATATATACACAAATGAATTCAAACCTAACATTGCCT
    CAAGATCGTTATTTAGATATTGCTGAATATATCGATGTTATGCATATCTCACACAACTGG
    GGAACAACTGATGAATTCGCAAATGTTGGCTTTGGCGCAATGAAGAAGCAACCACCGTTA
    AAAGCTAAGTTAAAATTATATGAACAAATGATTTCGAATGCACGTACATTATCAGAACAA
    GGAATGTTTGTATCTGCGGAAACAATGCTCAATCAAAGTACGCTACCACATTTACGAAAA
    ATACATCAAGAAGTCGTTCATGATATGAAATGTAGCAGACACGAGATTCACCCTATGTAT
    CCAGCTGACTTTGCAAGTCAATTAAATGTGTTAACTCTAGCGGAAATGAAAAAGACAATT
    CATGATATATTGGATTTCAGAGATGAAGATATTTGGATGTTATTTGGTACTTTGCCTGTG
    TTTCCATGCTTAAAGGATGATGAAGATCAAAAGTTACTATCACGTTTAAGAAATGCTAAA
    AATGTAACGACTAGAAATGACCCGGATGGCCGTAGTCGTTTAAATGTCAATGTATTTACA
    GGTAATGTAATCGTAACTGATTTCGGAGATGAAACAGGTACAATTTCGAATATACAAAAA
    GATAAATTAACAGATGTATTTGATAAATGGTTATCCTCTGATCTTGCTAAATCATTAAAT
    TGTCATTGTTCCGAGTTTAGTTGTTTAGGGCCAAATGTTCTTGTTAAAAATATGTACTAT
    CCGAATATGGATTTTAAAGATAATGAGCGTCATATGCACAAACAACCACAAATTATACAA
    TTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1146

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02090
  • symbol: SAOUHSC_02090
  • description: hypothetical protein
  • length: 381
  • theoretical pI: 6.91373
  • theoretical MW: 43987.1
  • GRAVY: -0.516535

Function[edit | edit source]

  • TIGRFAM:
    Unknown function Enzymes of unknown specificity radical SAM/CxCxxxxC motif protein YfkAB (TIGR04478; HMM-score: 616.2)
    and 38 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 27.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ2 (TIGR04055; EC 1.3.99.-; HMM-score: 27.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 24.7)
    radical SAM/Cys-rich domain protein (TIGR04167; HMM-score: 24.6)
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 24.6)
    Cellular processes Cellular processes Toxin production and resistance Cys-rich peptide radical SAM maturase CcpM (TIGR04068; HMM-score: 24.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 23.4)
    Unknown function Enzymes of unknown specificity radical SAM protein, BA_1875 family (TIGR04053; HMM-score: 23.4)
    hopanoid biosynthesis associated radical SAM protein HpnH (TIGR03470; HMM-score: 23.3)
    His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 22.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme b synthase (TIGR04545; EC 1.3.99.-; HMM-score: 21.8)
    pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 20.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03365; HMM-score: 19.6)
    His-Xaa-Ser system radical SAM maturase HxsB (TIGR03978; HMM-score: 19.2)
    SynChlorMet cassette radical SAM/SPASM protein ScmF (TIGR04251; HMM-score: 18.8)
    Unknown function Enzymes of unknown specificity mycofactocin radical SAM maturase (TIGR03962; HMM-score: 18.6)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 18)
    Genetic information processing Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 17.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 17.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 17.2)
    radical SAM/SPASM domain protein maturase (TIGR04463; HMM-score: 17.1)
    Genetic information processing Protein fate Protein modification and repair pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 16.7)
    Metabolism Energy metabolism Anaerobic pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 16.7)
    radical SAM protein, TatD family-associated (TIGR04038; HMM-score: 16.7)
    Genetic information processing Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 16.6)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 16.6)
    Unknown function Enzymes of unknown specificity archaeal radical SAM protein, PTO1314 family (TIGR03961; HMM-score: 16.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin probable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 16.2)
    SynChlorMet cassette radical SAM/SPASM protein ScmE (TIGR04250; HMM-score: 16)
    Signal transduction Regulatory functions Protein interactions peptide modification radical SAM enzyme, YydG family (TIGR04078; HMM-score: 15.7)
    putative geopeptide radical SAM maturase (TIGR04280; HMM-score: 15.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin 12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 15.5)
    radical SAM peptide maturase, GG-Bacteroidales family (TIGR04148; HMM-score: 14.9)
    glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 14.4)
    GeoRSP system radical SAM/SPASM protein (TIGR04303; HMM-score: 14.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit (TIGR03551; EC 2.5.1.77; HMM-score: 13.2)
    Cellular processes Cellular processes Adaptations to atypical conditions glutamate 2,3-aminomutase (TIGR04368; EC 5.4.3.9; HMM-score: 13.2)
    putative peptide-modifying radical SAM enzyme, AF0577 family (TIGR04084; HMM-score: 12.9)
  • TheSEED:  
    CBSS-176280.1.peg.1561  Hypothetical protein SAV1877
  • PFAM:
    no clan defined YfkB; YfkB-like domain (PF08756; HMM-score: 250.8)
    and 3 more
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 44.4)
    4Fe-4S (CL0344) Fer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 24.5)
    Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 23.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.125621
    • TAT(Tat/SPI): 0.001061
    • LIPO(Sec/SPII): 0.005851
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRNNKPKISIQNDPWEAYNDVKEHGQLTLSNIEFTTTNLCNMRCSHCAVGYTLQTVDPEPLDMDLIYRRLDEIPNLRTMSITGGEPMFSKKSIRNVVKPLLKYAHHRGIYTQMNSNLTLPQDRYLDIAEYIDVMHISHNWGTTDEFANVGFGAMKKQPPLKAKLKLYEQMISNARTLSEQGMFVSAETMLNQSTLPHLRKIHQEVVHDMKCSRHEIHPMYPADFASQLNVLTLAEMKKTIHDILDFRDEDIWMLFGTLPVFPCLKDDEDQKLLSRLRNAKNVTTRNDPDGRSRLNVNVFTGNVIVTDFGDETGTISNIQKDKLTDVFDKWLSSDLAKSLNCHCSEFSCLGPNVLVKNMYYPNMDFKDNERHMHKQPQIIQF

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAOUHSC_02090 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]