Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02211
- pan locus tag?: SAUPAN001412000
- symbol: SAOUHSC_02211
- pan gene symbol?: —
- synonym:
- product: phi PVL orf 50-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02211
- symbol: SAOUHSC_02211
- product: phi PVL orf 50-like protein
- replicon: chromosome
- strand: -
- coordinates: 2061857..2062228
- length: 372
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 3919576 NCBI
- RefSeq: YP_500696 NCBI
- BioCyc: G1I0R-2089 BioCyc
- MicrobesOnline: 1290652 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGCGAAAGCAGCAAGAATTGTAAGGATACACGATAAACCTTATAGGTTCAGTAAATTT
GAAATGGAATTAATAGAAAGTCACGGTATAACCGCTGGAATGGTTTCTAAGAGAGTAAAA
GACGGTTGGGAACTACATGAAGCAATGGACGCACCAGAAGGTACGCGTTTAAGCGAGTAC
AGAGAAAAGAAAACAATAGAAAGACTGGAACAAGCTAGACTCGAACGCAAATTGGAAAGA
AAGCGAAAGAGAGAGGCTGAGCTAAGAAGAAAGAAGCCACACTTGTTTAATGTACCTCAG
AAACATTCACGTGATCCGTACTGGTTTGATAATACTTATAACCAAATGTTCAAGAAGTGG
CAGGAAGTATAA60
120
180
240
300
360
372
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02211
- symbol: SAOUHSC_02211
- description: phi PVL orf 50-like protein
- length: 123
- theoretical pI: 10.5982
- theoretical MW: 15028.2
- GRAVY: -1.21138
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage phi 11 orf21 protein homolog
- PFAM: no clan defined PVL_ORF50; PVL ORF-50-like family (PF07768; HMM-score: 209.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9858
- Cytoplasmic Membrane Score: 0.0036
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0104
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002332
- TAT(Tat/SPI): 0.000194
- LIPO(Sec/SPII): 0.000501
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKAARIVRIHDKPYRFSKFEMELIESHGITAGMVSKRVKDGWELHEAMDAPEGTRLSEYREKKTIERLEQARLERKLERKRKREAELRRKKPHLFNVPQKHSRDPYWFDNTYNQMFKKWQEV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [1]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
