From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02216
  • pan locus tag?: SAUPAN001648000
  • symbol: SAOUHSC_02216
  • pan gene symbol?:
  • synonym:
  • product: phage DnaC-like protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02216
  • symbol: SAOUHSC_02216
  • product: phage DnaC-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2063220..2063999
  • length: 780
  • essential: no DEG

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAACCACTATTCAGCGAAAAGATAAACGAAAGCTTGAAAAAATATCAACCTACTCAT
    GTCGAAAAAGGATTGAAATGTGAGAGATGTGGAAGTGAATACGACTTATATAAGTTTGCT
    CCTACTAAAAAACACCCGAATGGTTACGAGTATAAAGACGGTTGCAAATGTGAAATCTAT
    GAGGAATATAAGCGAAACAAGCAACGGAAGATAAACAACATATTCAATCAATCAAACGTT
    AATCCGTCTTTAAGAGATGCAACAGTCAAAAACTACAAGCCACAAAATGAAAAACAAGTA
    CACGCTAAACAAACAGCAATAGAGTACGTACAAGGCTTCTCTACAAAAGAACCAAAATCA
    TTAATATTGCAAGGTTCATACGGAACTGGTAAAAGCCACCTAGCATACGCTATCGCAAAA
    GCAGTCAAAGCTAAAGGGCATACGGTTGCTTTTATGCACATACCAATGTTGATGGATCGT
    ATCAAAGCGACATACAACAAAAATGCAGTAGAGACTACAGACGAGTTAGTCAGATTGTTA
    AGCGATATTGATTTACTTGTACTAGATGATATGGGTGTAGAGAACACAGAACATACTTTA
    AACAAACTTTTCAGCATTGTTGATAACAGAGTAGGTAAAAACAACATCTTTACAACTAAC
    TTTAGTGATAAAGAACTAAATCAAAATATGAACTGGCAACGTATCAATTCAAGAATGAAA
    CACAATGCAAGAAAAGTAAGAGTAATCGGAGACGATTTCAGGGAGCGAGACGCATGGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02216
  • symbol: SAOUHSC_02216
  • description: phage DnaC-like protein
  • length: 259
  • theoretical pI: 9.83133
  • theoretical MW: 30058.1
  • GRAVY: -0.847876

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair chromosomal replication initiator protein DnaA (TIGR00362; HMM-score: 41.5)
    and 7 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 30.3)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 14)
    Genetic information processing Protein synthesis tRNA and rRNA base modification sulfur relay protein TusD/DsrE (TIGR03012; HMM-score: 13.8)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA polymerase III, delta' subunit (TIGR00678; EC 2.7.7.7; HMM-score: 13.5)
    Cellular processes Cellular processes Cell division ATP-dependent metallopeptidase HflB (TIGR01241; EC 3.4.24.-; HMM-score: 13)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent metallopeptidase HflB (TIGR01241; EC 3.4.24.-; HMM-score: 13)
    26S proteasome subunit P45 family (TIGR01242; HMM-score: 12)
  • TheSEED  :
    • Phage DNA helicase loader
    DNA Metabolism DNA replication DNA-replication  DNA replication protein DnaC
  • PFAM:
    P-loop_NTPase (CL0023) IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 66.6)
    and 29 more
    Bac_DnaA; Bacterial DnaA ATPAse domain (PF00308; HMM-score: 30)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 26.3)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 24.3)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 21.1)
    NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 20.9)
    ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 19.4)
    DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 19)
    AAA_30; AAA domain (PF13604; HMM-score: 18.5)
    PIF1; PIF1-like helicase (PF05970; HMM-score: 18.1)
    AFG1_ATPase; AFG1-like ATPase (PF03969; HMM-score: 17.5)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 17.3)
    BrxC_BrxD; BREX system ATP-binding protein BrxC/D (PF10923; HMM-score: 16.6)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 15.9)
    CheY (CL0304) Response_reg_2; Response receiver domain (PF19192; HMM-score: 15.8)
    S5 (CL0329) Morc6_S5; Morc6 ribosomal protein S5 domain 2-like (PF17942; HMM-score: 15.7)
    P-loop_NTPase (CL0023) Zeta_toxin; Zeta toxin (PF06414; HMM-score: 15.2)
    no clan defined DUF6371; Domain of unknown function (DUF6371) (PF19898; HMM-score: 15.2)
    RING (CL0229) STL11_N; STL11, N-terminal (PF21369; HMM-score: 14.7)
    P-loop_NTPase (CL0023) Torsin; Torsin (PF06309; HMM-score: 14.1)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 14)
    AAA_14; AAA domain (PF13173; HMM-score: 13.9)
    Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 13.1)
    NACHT; NACHT domain (PF05729; HMM-score: 13)
    AB_hydrolase (CL0028) Mbeg1-like; Mbeg1-like (PF11187; HMM-score: 12.7)
    NADP_Rossmann (CL0063) Eno-Rase_NADH_b; NAD(P)H binding domain of trans-2-enoyl-CoA reductase (PF12242; HMM-score: 11.1)
    P-loop_NTPase (CL0023) CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 10.7)
    AAA_11; AAA domain (PF13086; HMM-score: 10)
    ABC_tran; ABC transporter (PF00005; HMM-score: 9.9)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 9.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9816
    • Cytoplasmic Membrane Score: 0.0034
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0149
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.130401
    • TAT(Tat/SPI): 0.002622
    • LIPO(Sec/SPII): 0.021578
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKPLFSEKINESLKKYQPTHVEKGLKCERCGSEYDLYKFAPTKKHPNGYEYKDGCKCEIYEEYKRNKQRKINNIFNQSNVNPSLRDATVKNYKPQNEKQVHAKQTAIEYVQGFSTKEPKSLILQGSYGTGKSHLAYAIAKAVKAKGHTVAFMHIPMLMDRIKATYNKNAVETTDELVRLLSDIDLLVLDDMGVENTEHTLNKLFSIVDNRVGKNNIFTTNFSDKELNQNMNWQRINSRMKHNARKVRVIGDDFRERDAW

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]