Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02785
- pan locus tag?: SAUPAN006070000
- symbol: SAOUHSC_02785
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02785
- symbol: SAOUHSC_02785
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2558305..2558631
- length: 327
- essential: no [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921440 NCBI
- RefSeq: YP_501245 NCBI
- BioCyc: G1I0R-2625 BioCyc
- MicrobesOnline: 1291216 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTTACTACGTATAAAAATATTAATGAACTTGAAAATGCCTATGATGAAGAAAGAAAA
CAATTGAATGATGCATTCAATCAAATTGATGAATTAAGACATCAAACACGCAAGAAATGT
GAACAAATGTATGATCATTTCTTATATCTCAAACATAAAATGAATTATAGTGAAGACGCT
ATGATCAGGATGACACGTATTATAGAATCTTTCGATAGAGAAACGAATCAACGTATCCGA
CATCACGAAATGAAATTAGAAGATTATAAAGATGAGTTAAGAAGAGAATATCTAAAACAA
TCTGACAGAATTGAAGGAGATGAATAA60
120
180
240
300
327
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02785
- symbol: SAOUHSC_02785
- description: hypothetical protein
- length: 108
- theoretical pI: 5.63959
- theoretical MW: 13586.1
- GRAVY: -1.45
⊟Function[edit | edit source]
- TIGRFAM: two transmembrane protein (TIGR04527; HMM-score: 9.7)and 3 moreDNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 7.2)Protein fate Protein folding and stabilization chaperone protein DnaK (TIGR02350; HMM-score: 6.9)variant surface antigen, rifin family (TIGR01477; HMM-score: 5.3)
- TheSEED :
- FIG01107979: hypothetical protein
- PFAM: VPS23_C (CL0596) Mod_r; Modifier of rudimentary (Mod(r)) protein (PF07200; HMM-score: 15.7)no clan defined Jnk-SapK_ap_N; JNK_SAPK-associated protein-1 (PF09744; HMM-score: 15.4)AATF-Che1; Apoptosis antagonizing transcription factor (PF13339; HMM-score: 13.6)Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 12.8)and 9 moreHUP (CL0039) CDPS; Cyclodipeptide synthase (PF16715; HMM-score: 11.9)no clan defined DUF1043; Protein of unknown function (DUF1043) (PF06295; HMM-score: 11.6)SWIRM-assoc_1; SWIRM-associated region 1 (PF16495; HMM-score: 11.6)Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 10.8)Spc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 10.7)DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 10.2)V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 7.7)FliD_C; Flagellar hook-associated protein 2 C-terminus (PF07195; HMM-score: 7.4)FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 6.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004856
- TAT(Tat/SPI): 0.000517
- LIPO(Sec/SPII): 0.001212
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFTTYKNINELENAYDEERKQLNDAFNQIDELRHQTRKKCEQMYDHFLYLKHKMNYSEDAMIRMTRIIESFDRETNQRIRHHEMKLEDYKDELRREYLKQSDRIEGDE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]