Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 27-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAP007
- pan locus tag?:
- symbol: SAP007
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAP007
- symbol: SAP007
- product: hypothetical protein
- replicon: pN315
- strand: +
- coordinates: 5566..5733
- length: 168
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 1122744 NCBI
- RefSeq: NP_395543 NCBI
- BioCyc:
- MicrobesOnline: 143477 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATATTCACAGATGGTATAATAATAGAGTCGCCTATCTCTCAGGCGTCAATTGACGAAGAG
AGGAGGTGCATTACTTTGCTAATCATTTTCGTTCACATCATAGCACCAGTCATCAGTGGC
TGTGCTGTTGCGTATTATACTTATTGGCTTAGTAAACGCAACAAATAA60
120
168
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAP007
- symbol: SAP007
- description: hypothetical protein
- length: 55
- theoretical pI: 7.25026
- theoretical MW: 6260.34
- GRAVY: 0.532727
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: VISGCAV
- SignalP: Signal peptide LIPO(Sec/SPII) length 40 aa
- SP(Sec/SPI): 0.015503
- TAT(Tat/SPI): 0.005062
- LIPO(Sec/SPII): 0.513017
- Cleavage Site: CS pos: 40-41. ISG-CA. Pr: 0.4875
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFTDGIIIESPISQASIDEERRCITLLIIFVHIIAPVISGCAVAYYTYWLSKRNK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.