Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 27-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAP012 [new locus tag: SA_RS00050 ]
- pan locus tag?:
- symbol: blaI
- pan gene symbol?: —
- synonym:
- product: penicillinase repressor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAP012 [new locus tag: SA_RS00050 ]
- symbol: blaI
- product: penicillinase repressor
- replicon: pN315
- strand: +
- coordinates: 10644..11024
- length: 381
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 1122763 NCBI
- RefSeq: NP_395548 NCBI
- BioCyc: see SA_RS00050
- MicrobesOnline: 143482 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACCAATAAGCAAGTTGAAATATCTATGGCTGAATGGGATGTTATGAATATAATATGG
GATAAAAAATCAGTATCAGCTAATGAAATTGTAGTTGAAATTCAAAAATATAAAGAAGTT
AGTGATAAAACGATTAGAACATTAATCACAAGACTATATAAAAAAGAGATTATAAAACGA
TACAAATCAGAAAATATTTATTTTTACTCATCAAATATTAAAGAAGACGATATTAAAATG
AAAACTGCTAAAACCTTTCTTAATAAACTGTATGGAGGGGATATGAAAAGTTTAGTGCTG
AATTTTGCGAAAAATGAAGAATTAAATAACAAAGAAATTGAAGAATTGCGAGACATTTTA
AATGATATTAGTAAAAAGTAA60
120
180
240
300
360
381
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAP012 [new locus tag: SA_RS00050 ]
- symbol: BlaI
- description: penicillinase repressor
- length: 126
- theoretical pI: 9.4886
- theoretical MW: 14964.2
- GRAVY: -0.639683
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 76.1)Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 76.1)and 1 moreTranscription DNA-dependent RNA polymerase DNA-directed RNA polymerase delta subunit (TIGR04567; EC 2.7.7.6; HMM-score: 16.1)
- TheSEED :
- beta-lactamase repressor BlaI
Phages, Prophages, Transposable elements, Plasmids Transposable elements Tn552 Beta-lactamase repressor BlaIand 1 more - PFAM: HTH (CL0123) Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 119.9)and 4 moreMarR; MarR family (PF01047; HMM-score: 27.2)PDDEXK (CL0236) RNA_pol_Rpb5_N; RNA polymerase Rpb5, N-terminal domain (PF03871; HMM-score: 14)HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 12.9)HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: BlaR (sensor histidine kinase) sensing beta-lactam antibiotics
- genes regulated by BlaI, TF important in Beta-lactam resistanceRegPrecise
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008058
- TAT(Tat/SPI): 0.000264
- LIPO(Sec/SPII): 0.001804
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: BlaI (repression) regulon
BlaI (TF) important in Beta-lactam resistance; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.