From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 27-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP012 [new locus tag: SA_RS00050 ]
  • pan locus tag?:
  • symbol: blaI
  • pan gene symbol?:
  • synonym:
  • product: penicillinase repressor

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAP012 [new locus tag: SA_RS00050 ]
  • symbol: blaI
  • product: penicillinase repressor
  • replicon: pN315
  • strand: +
  • coordinates: 10644..11024
  • length: 381
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGACCAATAAGCAAGTTGAAATATCTATGGCTGAATGGGATGTTATGAATATAATATGG
    GATAAAAAATCAGTATCAGCTAATGAAATTGTAGTTGAAATTCAAAAATATAAAGAAGTT
    AGTGATAAAACGATTAGAACATTAATCACAAGACTATATAAAAAAGAGATTATAAAACGA
    TACAAATCAGAAAATATTTATTTTTACTCATCAAATATTAAAGAAGACGATATTAAAATG
    AAAACTGCTAAAACCTTTCTTAATAAACTGTATGGAGGGGATATGAAAAGTTTAGTGCTG
    AATTTTGCGAAAAATGAAGAATTAAATAACAAAGAAATTGAAGAATTGCGAGACATTTTA
    AATGATATTAGTAAAAAGTAA
    60
    120
    180
    240
    300
    360
    381

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAP012 [new locus tag: SA_RS00050 ]
  • symbol: BlaI
  • description: penicillinase repressor
  • length: 126
  • theoretical pI: 9.4886
  • theoretical MW: 14964.2
  • GRAVY: -0.639683

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 76.1)
    Signal transduction Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 76.1)
    and 1 more
    Genetic information processing Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase delta subunit (TIGR04567; EC 2.7.7.6; HMM-score: 16.1)
  • TheSEED  :
    • beta-lactamase repressor BlaI
    Phages, Prophages, Transposable elements, Plasmids Transposable elements Tn552  Beta-lactamase repressor BlaI
    and 1 more
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Beta-lactamase  Beta-lactamase repressor BlaI
  • PFAM:
    HTH (CL0123) Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 109.6)
    and 8 more
    MarR; MarR family (PF01047; HMM-score: 27.7)
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 21.2)
    EF_hand (CL0220) DAG_kinase_N; Diacylglycerol kinase N-terminus (PF14513; HMM-score: 14.9)
    PDDEXK (CL0236) RNA_pol_Rpb5_N; RNA polymerase Rpb5, N-terminal domain (PF03871; HMM-score: 14.5)
    no clan defined DUF7240; Family of unknown function (DUF7240) (PF23888; HMM-score: 13.1)
    HTH (CL0123) PH0730-like_N; PH0730-like, N-terminal domain (PF22167; HMM-score: 12.5)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.1)
    HTH_71; HTH 3-helical bundle (PF23737; HMM-score: 9.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effector: BlaR (sensor histidine kinase) sensing beta-lactam antibiotics
  • genes regulated by BlaI, TF important in Beta-lactam resistanceRegPrecise
    repression

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9221
    • Cytoplasmic Membrane Score: 0.0034
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0745
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008058
    • TAT(Tat/SPI): 0.000264
    • LIPO(Sec/SPII): 0.001804
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: BlaI (repression) regulon
    BlaI(TF)important in Beta-lactam resistance; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]