From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 27-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP013 [new locus tag: SA_RS00055 ]
  • pan locus tag?:
  • symbol: binL
  • pan gene symbol?:
  • synonym:
  • product: DNA-invertase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAP013 [new locus tag: SA_RS00055 ]
  • symbol: binL
  • product: DNA-invertase
  • replicon: pN315
  • strand: +
  • coordinates: 11288..11881
  • length: 594
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAAAATAGGTTATGCAAGAGTTTCAACTGGATTACAAAATTTAAATTTACAGGAGGAT
    CGATTAAATACATATGGTTGTGAAAAGATATTTAATGACCATATGAGTGGTTCAAAAAGT
    AAAAGACCTGGTTTAGATAAAGCAATTGAATTTGCGAGGTCAGGAGATACGATTGTTGTT
    TGGAGATTAGATAGATTGGGACGTAATATGGAGGATTTAATCACATTAGTTAATGAGCTT
    AACGAACGAGGTGTAAGTTTCCATAGTTTAGAAGAAAATATAACAATGGATAAATCAAGT
    TCAACTGGACAATTATTATTTCATTTATTCGCAGCATTTGCAGAATTTGAACGTAATTTA
    ATTTTAGAGCGTTCTTCAGCTGGCCGAATTGCAGCACGTGCTAGAGGCCGATATGGAGGC
    AGACCAGAAAAATTAAATCAAAAAGATTTAAACTTACTTAAGACACTTTATGATAATGGC
    ACGCCAATTAAGACAATTGCAGAACAGTGGCATGTTTCACGTACAACAATTTATCGTTAC
    CTCAATAAATTGGAGGACAAGGAAGATGAAAAACAAGGAGAAGTATCTAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    594


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAP013 [new locus tag: SA_RS00055 ]
  • symbol: BinL
  • description: DNA-invertase
  • length: 197
  • theoretical pI: 8.95113
  • theoretical MW: 22526.3
  • GRAVY: -0.667513

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 33.3)
    and 3 more
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 19.4)
    RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 16.4)
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 14.5)
  • TheSEED  :
    • Phage DNA invertase
    • Resolvase/integrase Bin
    Phages, Prophages, Transposable elements, Plasmids Transposable elements Tn552  Resolvase/integrase Bin
  • PFAM:
    no clan defined Resolvase; Resolvase, N terminal domain (PF00239; HMM-score: 155.2)
    and 34 more
    HTH (CL0123) HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 67.8)
    HTH_11; HTH domain (PF08279; HMM-score: 27.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 24.4)
    HTH_22; HTH domain (PF13309; HMM-score: 24)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.4)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 21.4)
    Mga; Mga helix-turn-helix domain (PF05043; HMM-score: 20.8)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 19.9)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 19.6)
    MarR; MarR family (PF01047; HMM-score: 19.5)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 17.3)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 17.2)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 16.3)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.7)
    UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 15.3)
    Trp_repressor; Trp repressor protein (PF01371; HMM-score: 15.2)
    HTH_30; PucR C-terminal helix-turn-helix domain (PF13556; HMM-score: 15.2)
    MarR_2; MarR family (PF12802; HMM-score: 15.1)
    TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 14.7)
    HTH_50; Helix-turn-helix domain (PF18024; HMM-score: 14.3)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 14.2)
    HTH_32; Homeodomain-like domain (PF13565; HMM-score: 13.9)
    HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 13.9)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 13.8)
    HTH_69; Winged helix-turn-helix domain (PF22979; HMM-score: 13.5)
    TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 13.2)
    HTH_Tnp_1; Transposase (PF01527; HMM-score: 13)
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 12.9)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.3)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.2)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 11.8)
    GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 11.7)
    HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 11.7)
    RuvB_C; RuvB C-terminal winged helix domain (PF05491; HMM-score: 11.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9957
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0042
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013885
    • TAT(Tat/SPI): 0.000743
    • LIPO(Sec/SPII): 0.012243
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKIGYARVSTGLQNLNLQEDRLNTYGCEKIFNDHMSGSKSKRPGLDKAIEFARSGDTIVVWRLDRLGRNMEDLITLVNELNERGVSFHSLEENITMDKSSSTGQLLFHLFAAFAEFERNLILERSSAGRIAARARGRYGGRPEKLNQKDLNLLKTLYDNGTPIKTIAEQWHVSRTTIYRYLNKLEDKEDEKQGEVSN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]