Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 27-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAP013 [new locus tag: SA_RS00055 ]
- pan locus tag?:
- symbol: binL
- pan gene symbol?: —
- synonym:
- product: DNA-invertase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAP013 [new locus tag: SA_RS00055 ]
- symbol: binL
- product: DNA-invertase
- replicon: pN315
- strand: +
- coordinates: 11288..11881
- length: 594
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 1122762 NCBI
- RefSeq: NP_395549 NCBI
- BioCyc: see SA_RS00055
- MicrobesOnline: 143483 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541TTGAAAATAGGTTATGCAAGAGTTTCAACTGGATTACAAAATTTAAATTTACAGGAGGAT
CGATTAAATACATATGGTTGTGAAAAGATATTTAATGACCATATGAGTGGTTCAAAAAGT
AAAAGACCTGGTTTAGATAAAGCAATTGAATTTGCGAGGTCAGGAGATACGATTGTTGTT
TGGAGATTAGATAGATTGGGACGTAATATGGAGGATTTAATCACATTAGTTAATGAGCTT
AACGAACGAGGTGTAAGTTTCCATAGTTTAGAAGAAAATATAACAATGGATAAATCAAGT
TCAACTGGACAATTATTATTTCATTTATTCGCAGCATTTGCAGAATTTGAACGTAATTTA
ATTTTAGAGCGTTCTTCAGCTGGCCGAATTGCAGCACGTGCTAGAGGCCGATATGGAGGC
AGACCAGAAAAATTAAATCAAAAAGATTTAAACTTACTTAAGACACTTTATGATAATGGC
ACGCCAATTAAGACAATTGCAGAACAGTGGCATGTTTCACGTACAACAATTTATCGTTAC
CTCAATAAATTGGAGGACAAGGAAGATGAAAAACAAGGAGAAGTATCTAACTAA60
120
180
240
300
360
420
480
540
594
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAP013 [new locus tag: SA_RS00055 ]
- symbol: BinL
- description: DNA-invertase
- length: 197
- theoretical pI: 8.95113
- theoretical MW: 22526.3
- GRAVY: -0.667513
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 33.3)and 3 moreRNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 19.4)RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 16.4)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 14.5)
- TheSEED :
- Phage DNA invertase
- Resolvase/integrase Bin
- PFAM: no clan defined Resolvase; Resolvase, N terminal domain (PF00239; HMM-score: 155.2)and 34 moreHTH (CL0123) HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 67.8)HTH_11; HTH domain (PF08279; HMM-score: 27.7)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 24.4)HTH_22; HTH domain (PF13309; HMM-score: 24)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.4)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 21.4)Mga; Mga helix-turn-helix domain (PF05043; HMM-score: 20.8)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 19.9)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 19.6)MarR; MarR family (PF01047; HMM-score: 19.5)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 17.3)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 17.2)HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 16.3)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.7)UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 15.3)Trp_repressor; Trp repressor protein (PF01371; HMM-score: 15.2)HTH_30; PucR C-terminal helix-turn-helix domain (PF13556; HMM-score: 15.2)MarR_2; MarR family (PF12802; HMM-score: 15.1)TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 14.7)HTH_50; Helix-turn-helix domain (PF18024; HMM-score: 14.3)Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 14.2)HTH_32; Homeodomain-like domain (PF13565; HMM-score: 13.9)HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 13.9)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 13.8)HTH_69; Winged helix-turn-helix domain (PF22979; HMM-score: 13.5)TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 13.2)HTH_Tnp_1; Transposase (PF01527; HMM-score: 13)Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 12.9)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.3)HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.2)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 11.8)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 11.7)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 11.7)RuvB_C; RuvB C-terminal winged helix domain (PF05491; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9957
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0042
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013885
- TAT(Tat/SPI): 0.000743
- LIPO(Sec/SPII): 0.012243
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIGYARVSTGLQNLNLQEDRLNTYGCEKIFNDHMSGSKSKRPGLDKAIEFARSGDTIVVWRLDRLGRNMEDLITLVNELNERGVSFHSLEENITMDKSSSTGQLLFHLFAAFAEFERNLILERSSAGRIAARARGRYGGRPEKLNQKDLNLLKTLYDNGTPIKTIAEQWHVSRTTIYRYLNKLEDKEDEKQGEVSN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: binL > tnp > sin
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]