Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS025 [new locus tag: SA_RS04775 ]
- pan locus tag?: SAUPAN003126000
- symbol: SAS025
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS025 [new locus tag: SA_RS04775 ]
- symbol: SAS025
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 954670..954855
- length: 186
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123658 NCBI
- RefSeq: NP_374104 NCBI
- BioCyc: see SA_RS04775
- MicrobesOnline: 103130 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAACACCTCGTAACATTCTTTTGGGCATTATTATTAATGCAAATGGTTAACTTTGTA
CTTAATAGCCTAGTAGGTGGAGACAGCTTAAATGTAGTGAATCCAATTATCATGGCAGTA
TTGTTCACGATTTTCACAGCAATTTTTGCTGCAGTAATTAAACCGCCGAAAGATTCATCA
CAATAA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS025 [new locus tag: SA_RS04775 ]
- symbol: SAS025
- description: hypothetical protein
- length: 61
- theoretical pI: 9.44367
- theoretical MW: 6753.15
- GRAVY: 1.06885
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01107844: hypothetical protein
- PFAM: no clan defined DUF2929; Protein of unknown function (DUF2929) (PF11151; HMM-score: 67.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9992
- Cell wall & surface Score: 0
- Extracellular Score: 0.0007
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.173747
- TAT(Tat/SPI): 0.001081
- LIPO(Sec/SPII): 0.111387
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKHLVTFFWALLLMQMVNFVLNSLVGGDSLNVVNPIIMAVLFTIFTAIFAAVIKPPKDSSQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]