Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS029
- pan locus tag?: SAUPAN003220000
- symbol: SAS029
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS029
- symbol: SAS029
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1007021..1007293
- length: 273
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1123708 NCBI
- RefSeq: NP_374152 NCBI
- BioCyc:
- MicrobesOnline: 103178 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATTTTTGGCACTATATTATATTTAACTTTAGCACTTGGATTATCAACAGCAGCTTATGCA
TCTACAGAATACGCAGAAGGAGGCACTTGGAGTCACGGTGTCGGCAGTAAGTATGTTTGG
TCTTATTATTATCATGGTCATAAAGGACATGGTGCAACAGCTATTGGAAAATATAGATCA
TTTAGTGGTTATACAAGAGCTGGTGTAAAAGCAAAAGCATCAGCTACTAAACATAATTGC
TGGGTCAATAGAGCGTATTATAACATTTATTAA60
120
180
240
273
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS029
- symbol: SAS029
- description: hypothetical protein
- length: 90
- theoretical pI: 9.8711
- theoretical MW: 9932.07
- GRAVY: -0.273333
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance bacteriocin, lactococcin 972 family (TIGR01653; HMM-score: 37.3)
- TheSEED:
- PFAM: no clan defined Lactococcin_972; Bacteriocin (Lactococcin_972) (PF09683; HMM-score: 47.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 1
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: AYASTEYA
- SignalP: Signal peptide SP(Sec/SPI) length 20 aa
- SP(Sec/SPI): 0.978106
- TAT(Tat/SPI): 0.00649
- LIPO(Sec/SPII): 0.011467
- Cleavage Site: CS pos: 20-21. AYA-ST. Pr: 0.7652
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFGTILYLTLALGLSTAAYASTEYAEGGTWSHGVGSKYVWSYYYHGHKGHGATAIGKYRSFSGYTRAGVKAKASATKHNCWVNRAYYNIY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAS029 > SA0886 > SA0887 > SA0888
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]