Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS055
- pan locus tag?: SAUPAN004971000
- symbol: tnp
- pan gene symbol?: tnp
- synonym:
- product: transposase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS055
- symbol: tnp
- product: transposase
- replicon: chromosome
- strand: -
- coordinates: 1991916..1992089
- length: 174
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124623 NCBI
- RefSeq: NP_375030 NCBI
- BioCyc:
- MicrobesOnline: 104056 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATAGAAACTTCTGTTAGAATCCCTCAAAATGATATTTCACGATATGTTAATGAAATTGTT
GAAACAATACCTGATAGCGAATTCGATGAATTCAGACATCATCGTGGCGCAACATCCTAT
CATCCAAAAATGATGTTAAAAATCATCTTATATGCATATACTCAATCTGTTTAA60
120
174
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS055
- symbol: Tnp
- description: transposase
- length: 57
- theoretical pI: 6.23002
- theoretical MW: 6758.62
- GRAVY: -0.496491
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF772; Transposase domain (DUF772) (PF05598; HMM-score: 19.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8914
- Cytoplasmic Membrane Score: 0.0747
- Cell wall & surface Score: 0.0022
- Extracellular Score: 0.0317
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.019602
- TAT(Tat/SPI): 0.001492
- LIPO(Sec/SPII): 0.003059
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- METSVRIPQNDISRYVNEIVETIPDSEFDEFRHHRGATSYHPKMMLKIILYAYTQSV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]