From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS058 [new locus tag: SA_RS10070 ]
  • pan locus tag?: SAUPAN005014000
  • symbol: SAS058
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAS058 [new locus tag: SA_RS10070 ]
  • symbol: SAS058
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2005721..2005900
  • length: 180
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGAAATTTAAAACAACTAAAGAATGTAAAAGTAATAATATCTTTAAAAGAAGTCAAGAA
    ATTAATAATAGAGAAAGTGAAAAGGGTTGTTTATGGGGCATTAGCATGTTGATTCTACTT
    TTCTTATTGATTCTGTTTGGAATAACTGCTTGTTCATCAAGCATTCACTTTATTAATTAG
    60
    120
    180


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAS058 [new locus tag: SA_RS10070 ]
  • symbol: SAS058
  • description: hypothetical protein
  • length: 59
  • theoretical pI: 9.56785
  • theoretical MW: 6798.04
  • GRAVY: 0.157627

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Phage protein
  • PFAM:
    no clan defined KASH; Nuclear envelope localisation domain (PF10541; HMM-score: 8.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.854
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.146
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: GITACSS
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.023941
    • TAT(Tat/SPI): 0.002043
    • LIPO(Sec/SPII): 0.454654
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKFKTTKECKSNNIFKRSQEINNRESEKGCLWGISMLILLFLLILFGITACSSSIHFIN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]