From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS067 [new locus tag: SA_RS10780 ]
  • pan locus tag?: SAUPAN005340000
  • symbol: SAS067
  • pan gene symbol?: mazE
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAS067 [new locus tag: SA_RS10780 ]
  • symbol: SAS067
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2121531..2121701
  • length: 171
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGTTATCTTTTAGTCAAAATAGAAGTCATAGCTTAGAACAATCTTTAAAAGAAGGATAT
    TCACAAATGGCTGATTTAAATCTCTCCCTAGCGAACGAAGCTTTTCCGATAGAGTGTGAA
    GCATGCGATTGCAACGAAACATATTTATCTTCTAATTCAACGAATGAATGA
    60
    120
    171

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAS067 [new locus tag: SA_RS10780 ]
  • symbol: SAS067
  • description: hypothetical protein
  • length: 56
  • theoretical pI: 3.83056
  • theoretical MW: 6251.76
  • GRAVY: -0.596429

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Programmed cell death antitoxin MazE
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems MazEF toxin-antitoxing (programmed cell death) system  Programmed cell death antitoxin YdcD
    and 1 more
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems Phd-Doc, YdcE-YdcD toxin-antitoxin (programmed cell death) systems  Programmed cell death antitoxin YdcD
  • PFAM:

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.085783
    • TAT(Tat/SPI): 0.019413
    • LIPO(Sec/SPII): 0.012313
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAS067&oldid=91802"